BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0301 (671 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_01_0404 + 3053558-3053939,3054028-3054123,3054217-3054309,305... 28 5.9 >01_01_0404 + 3053558-3053939,3054028-3054123,3054217-3054309, 3054432-3054517,3054633-3054896,3055076-3055203, 3055306-3055401,3055580-3055685,3055778-3055942 Length = 471 Score = 28.3 bits (60), Expect = 5.9 Identities = 10/30 (33%), Positives = 19/30 (63%) Frame = +2 Query: 134 YSTRATPIFKPKPNQTIPDGFSFLINYLKK 223 YS + +F N+T D ++FL+N+L++ Sbjct: 144 YSNTTSDLFTAGDNKTAHDSYAFLVNWLER 173 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,870,003 Number of Sequences: 37544 Number of extensions: 309440 Number of successful extensions: 517 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 508 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 517 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1703141568 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -