BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0300 (641 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Y14277-1|CAA74654.1| 1116|Drosophila melanogaster nuclear protei... 30 2.3 AY061578-1|AAL29126.1| 889|Drosophila melanogaster SD02883p pro... 28 9.4 AE014296-2904|AAF49347.2| 889|Drosophila melanogaster CG3885-PA... 28 9.4 >Y14277-1|CAA74654.1| 1116|Drosophila melanogaster nuclear protein SA protein. Length = 1116 Score = 30.3 bits (65), Expect = 2.3 Identities = 12/41 (29%), Positives = 23/41 (56%) Frame = +1 Query: 475 KSESENKASREPLDRGERERTKAS*VVSFIHSLPYYKRRHA 597 + E + +EP+D+G ER ++ ++ + PYY RH+ Sbjct: 73 RKERVERPRKEPVDKGHHERIQSEREITTDENSPYYIVRHS 113 >AY061578-1|AAL29126.1| 889|Drosophila melanogaster SD02883p protein. Length = 889 Score = 28.3 bits (60), Expect = 9.4 Identities = 25/95 (26%), Positives = 40/95 (42%), Gaps = 10/95 (10%) Frame = -3 Query: 612 AEPSPCVPSLIIGKAVYKRNDLARFRPFPLSTVEWFARR------FIFALALSKLYNIYL 451 A P P V +I ++ + + R R + L ++W R F L L KLY Y Sbjct: 49 APPVPVVTLCLIKQSEQREGEYKRKRSWQLDEIKWVDGRNEQFQTHEFDLQLEKLYKWYA 108 Query: 450 VLSSRNES----VAR*ILLSTRLKKFHFKN*ATAW 358 + ++ + R I S R ++ F+N AW Sbjct: 109 LNPHERQNFLAVLNRQIQKSVRGQRAEFRNVPAAW 143 >AE014296-2904|AAF49347.2| 889|Drosophila melanogaster CG3885-PA protein. Length = 889 Score = 28.3 bits (60), Expect = 9.4 Identities = 25/95 (26%), Positives = 40/95 (42%), Gaps = 10/95 (10%) Frame = -3 Query: 612 AEPSPCVPSLIIGKAVYKRNDLARFRPFPLSTVEWFARR------FIFALALSKLYNIYL 451 A P P V +I ++ + + R R + L ++W R F L L KLY Y Sbjct: 49 APPVPVVTLCLIKQSEQREGEYKRKRSWQLDEIKWVDGRNEQFETHEFDLQLEKLYKWYA 108 Query: 450 VLSSRNES----VAR*ILLSTRLKKFHFKN*ATAW 358 + ++ + R I S R ++ F+N AW Sbjct: 109 LNPHERQNFLAVLNRQIQKSVRGQRAEFRNVPAAW 143 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,747,289 Number of Sequences: 53049 Number of extensions: 480635 Number of successful extensions: 923 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 900 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 923 length of database: 24,988,368 effective HSP length: 82 effective length of database: 20,638,350 effective search space used: 2703623850 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -