BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0300 (641 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. 21 7.7 AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. 21 7.7 AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. 21 7.7 AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. 21 7.7 AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. 21 7.7 AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. 21 7.7 AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. 21 7.7 AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 21 7.7 >AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.4 bits (43), Expect = 7.7 Identities = 15/46 (32%), Positives = 24/46 (52%), Gaps = 4/46 (8%) Frame = +2 Query: 437 RLERTR*ILYNLERARAK--IKRLANHSTVERGKGR--KRARSFLL 562 RL++ + Y L RAR K KR + S RG+ +++F+L Sbjct: 54 RLKKKMILEYELRRAREKKLSKRSKSRSPESRGRSNASNTSKTFIL 99 >AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.4 bits (43), Expect = 7.7 Identities = 15/46 (32%), Positives = 24/46 (52%), Gaps = 4/46 (8%) Frame = +2 Query: 437 RLERTR*ILYNLERARAK--IKRLANHSTVERGKGR--KRARSFLL 562 RL++ + Y L RAR K KR + S RG+ +++F+L Sbjct: 54 RLKKKMILEYELRRAREKKLSKRSKSRSPESRGRSNASNTSKTFIL 99 >AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.4 bits (43), Expect = 7.7 Identities = 15/46 (32%), Positives = 24/46 (52%), Gaps = 4/46 (8%) Frame = +2 Query: 437 RLERTR*ILYNLERARAK--IKRLANHSTVERGKGR--KRARSFLL 562 RL++ + Y L RAR K KR + S RG+ +++F+L Sbjct: 54 RLKKKMILEYELRRAREKKLSKRSKSRSPESRGRSNASNTSKTFIL 99 >AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.4 bits (43), Expect = 7.7 Identities = 15/46 (32%), Positives = 24/46 (52%), Gaps = 4/46 (8%) Frame = +2 Query: 437 RLERTR*ILYNLERARAK--IKRLANHSTVERGKGR--KRARSFLL 562 RL++ + Y L RAR K KR + S RG+ +++F+L Sbjct: 54 RLKKKMILEYELRRAREKKLSKRSKSRSPESRGRSNASNTSKTFIL 99 >AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.4 bits (43), Expect = 7.7 Identities = 15/46 (32%), Positives = 24/46 (52%), Gaps = 4/46 (8%) Frame = +2 Query: 437 RLERTR*ILYNLERARAK--IKRLANHSTVERGKGR--KRARSFLL 562 RL++ + Y L RAR K KR + S RG+ +++F+L Sbjct: 54 RLKKKMILEYELRRAREKKLSKRSKSRSPESRGRSNASNTSKTFIL 99 >AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.4 bits (43), Expect = 7.7 Identities = 15/46 (32%), Positives = 24/46 (52%), Gaps = 4/46 (8%) Frame = +2 Query: 437 RLERTR*ILYNLERARAK--IKRLANHSTVERGKGR--KRARSFLL 562 RL++ + Y L RAR K KR + S RG+ +++F+L Sbjct: 54 RLKKKMILEYELRRAREKKLSKRSKSRSPESRGRSNASNTSKTFIL 99 >AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. Length = 400 Score = 21.4 bits (43), Expect = 7.7 Identities = 15/46 (32%), Positives = 24/46 (52%), Gaps = 4/46 (8%) Frame = +2 Query: 437 RLERTR*ILYNLERARAK--IKRLANHSTVERGKGR--KRARSFLL 562 RL++ + Y L RAR K KR + S RG+ +++F+L Sbjct: 54 RLKKKMILEYELRRAREKKLSKRSKSRSPESRGRSNASNTSKTFIL 99 >AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 21.4 bits (43), Expect = 7.7 Identities = 15/46 (32%), Positives = 24/46 (52%), Gaps = 4/46 (8%) Frame = +2 Query: 437 RLERTR*ILYNLERARAK--IKRLANHSTVERGKGR--KRARSFLL 562 RL++ + Y L RAR K KR + S RG+ +++F+L Sbjct: 54 RLKKKMILEYELRRAREKKLSKRSKSRSPESRGRSNASNTSKTFIL 99 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 167,007 Number of Sequences: 438 Number of extensions: 4081 Number of successful extensions: 12 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19315974 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -