BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0299 (601 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value L76433-1|AAC27659.1| 392|Anopheles gambiae tryptophan oxygenase... 26 1.1 L76432-1|AAC27663.1| 392|Anopheles gambiae tryptophan oxygenase... 26 1.1 AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 25 2.5 AB090814-2|BAC57904.1| 1049|Anopheles gambiae reverse transcript... 24 4.3 AY752907-1|AAV30081.1| 97|Anopheles gambiae peroxidase 13A pro... 23 5.7 U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse tra... 23 10.0 DQ396551-1|ABD60146.1| 354|Anopheles gambiae adipokinetic hormo... 23 10.0 AY825592-1|AAV70203.1| 160|Anopheles gambiae cytochrome P450 pr... 23 10.0 AY825591-1|AAV70202.1| 160|Anopheles gambiae cytochrome P450 pr... 23 10.0 AY825590-1|AAV70201.1| 168|Anopheles gambiae cytochrome P450 pr... 23 10.0 AY825589-1|AAV70200.1| 168|Anopheles gambiae cytochrome P450 pr... 23 10.0 AY825588-1|AAV70199.1| 168|Anopheles gambiae cytochrome P450 pr... 23 10.0 AY825587-1|AAV70198.1| 168|Anopheles gambiae cytochrome P450 pr... 23 10.0 AY825586-1|AAV70197.1| 160|Anopheles gambiae cytochrome P450 pr... 23 10.0 AY825585-1|AAV70196.1| 160|Anopheles gambiae cytochrome P450 pr... 23 10.0 AY825584-1|AAV70195.1| 160|Anopheles gambiae cytochrome P450 pr... 23 10.0 AY825583-1|AAV70194.1| 160|Anopheles gambiae cytochrome P450 pr... 23 10.0 AY825582-1|AAV70193.1| 168|Anopheles gambiae cytochrome P450 pr... 23 10.0 AY825581-1|AAV70192.1| 168|Anopheles gambiae cytochrome P450 pr... 23 10.0 AY825580-1|AAV70191.1| 169|Anopheles gambiae cytochrome P450 pr... 23 10.0 AY825579-1|AAV70190.1| 169|Anopheles gambiae cytochrome P450 pr... 23 10.0 AY825578-1|AAV70189.1| 171|Anopheles gambiae cytochrome P450 pr... 23 10.0 AY825577-1|AAV70188.1| 171|Anopheles gambiae cytochrome P450 pr... 23 10.0 AY825576-1|AAV70187.1| 168|Anopheles gambiae cytochrome P450 pr... 23 10.0 AY825575-1|AAV70186.1| 168|Anopheles gambiae cytochrome P450 pr... 23 10.0 AY825574-1|AAV70185.1| 172|Anopheles gambiae cytochrome P450 pr... 23 10.0 AY825573-1|AAV70184.1| 172|Anopheles gambiae cytochrome P450 pr... 23 10.0 AY825572-1|AAV70183.1| 168|Anopheles gambiae cytochrome P450 pr... 23 10.0 AY825571-1|AAV70182.1| 168|Anopheles gambiae cytochrome P450 pr... 23 10.0 AY825570-1|AAV70181.1| 157|Anopheles gambiae cytochrome P450 pr... 23 10.0 AY825569-1|AAV70180.1| 157|Anopheles gambiae cytochrome P450 pr... 23 10.0 AY825568-1|AAV70179.1| 172|Anopheles gambiae cytochrome P450 pr... 23 10.0 AY825567-1|AAV70178.1| 172|Anopheles gambiae cytochrome P450 pr... 23 10.0 AY825566-1|AAV70177.1| 173|Anopheles gambiae cytochrome P450 pr... 23 10.0 AY825565-1|AAV70176.1| 173|Anopheles gambiae cytochrome P450 pr... 23 10.0 AY825564-1|AAV70175.1| 175|Anopheles gambiae cytochrome P450 pr... 23 10.0 AY825563-1|AAV70174.1| 175|Anopheles gambiae cytochrome P450 pr... 23 10.0 AY825562-1|AAV70173.1| 166|Anopheles gambiae cytochrome P450 pr... 23 10.0 AY825561-1|AAV70172.1| 166|Anopheles gambiae cytochrome P450 pr... 23 10.0 AY825560-1|AAV70171.1| 168|Anopheles gambiae cytochrome P450 pr... 23 10.0 AY825559-1|AAV70170.1| 168|Anopheles gambiae cytochrome P450 pr... 23 10.0 AY825558-1|AAV70169.1| 172|Anopheles gambiae cytochrome P450 pr... 23 10.0 AY825557-1|AAV70168.1| 172|Anopheles gambiae cytochrome P450 pr... 23 10.0 AY825556-1|AAV70167.1| 170|Anopheles gambiae cytochrome P450 pr... 23 10.0 AY825555-1|AAV70166.1| 170|Anopheles gambiae cytochrome P450 pr... 23 10.0 AY825554-1|AAV70165.1| 156|Anopheles gambiae cytochrome P450 pr... 23 10.0 AY825553-1|AAV70164.1| 156|Anopheles gambiae cytochrome P450 pr... 23 10.0 AY825552-1|AAV70163.1| 168|Anopheles gambiae cytochrome P450 pr... 23 10.0 AY825551-1|AAV70162.1| 168|Anopheles gambiae cytochrome P450 pr... 23 10.0 AY825550-1|AAV70161.1| 166|Anopheles gambiae cytochrome P450 pr... 23 10.0 AY825549-1|AAV70160.1| 166|Anopheles gambiae cytochrome P450 pr... 23 10.0 AY825548-1|AAV70159.1| 173|Anopheles gambiae cytochrome P450 pr... 23 10.0 AY825547-1|AAV70158.1| 173|Anopheles gambiae cytochrome P450 pr... 23 10.0 AY825546-1|AAV70157.1| 170|Anopheles gambiae cytochrome P450 pr... 23 10.0 AY825545-1|AAV70156.1| 170|Anopheles gambiae cytochrome P450 pr... 23 10.0 AY825544-1|AAV70155.1| 172|Anopheles gambiae cytochrome P450 pr... 23 10.0 AY825543-1|AAV70154.1| 172|Anopheles gambiae cytochrome P450 pr... 23 10.0 AY298745-1|AAQ63187.1| 354|Anopheles gambiae G-protein coupled ... 23 10.0 AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodi... 23 10.0 AJ970250-1|CAI96722.1| 132|Anopheles gambiae putative reverse t... 23 10.0 AJ010299-1|CAA09070.1| 722|Anopheles gambiae stat protein. 23 10.0 >L76433-1|AAC27659.1| 392|Anopheles gambiae tryptophan oxygenase protein. Length = 392 Score = 25.8 bits (54), Expect = 1.1 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +3 Query: 225 HLFVRVHFYDEFTYKDIFNVLRCYRDMITTWYSEE 329 HLF+ H E +K I L RD+ +T + EE Sbjct: 55 HLFIVTHQAYELWFKQIIFELDSIRDLFSTEHIEE 89 >L76432-1|AAC27663.1| 392|Anopheles gambiae tryptophan oxygenase protein. Length = 392 Score = 25.8 bits (54), Expect = 1.1 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +3 Query: 225 HLFVRVHFYDEFTYKDIFNVLRCYRDMITTWYSEE 329 HLF+ H E +K I L RD+ +T + EE Sbjct: 55 HLFIVTHQAYELWFKQIIFELDSIRDLFSTEHIEE 89 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 24.6 bits (51), Expect = 2.5 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = +2 Query: 509 HDCRSPRSRSYVRTNKRTILVEKYATR 589 +D R+ R+ VR T+L EKY R Sbjct: 2552 YDVRAERTFKQVRAKDETVLSEKYYIR 2578 >AB090814-2|BAC57904.1| 1049|Anopheles gambiae reverse transcriptase protein. Length = 1049 Score = 23.8 bits (49), Expect = 4.3 Identities = 11/36 (30%), Positives = 18/36 (50%) Frame = +3 Query: 456 QYPTPSEIKKILRDHHDSTTAGHPGVARMLGRIKEL 563 Q+P+ +I+K++ GHP R LG + L Sbjct: 505 QFPSMWKIQKLVLIPKPGKPPGHPSAFRPLGLVDNL 540 >AY752907-1|AAV30081.1| 97|Anopheles gambiae peroxidase 13A protein. Length = 97 Score = 23.4 bits (48), Expect = 5.7 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = +3 Query: 144 TTMPDIREVERELYSFYSTGNASHLFTHLFV 236 T PD+R YS YS+ N + +F + V Sbjct: 24 TNNPDLRLENGGYYSGYSSANRAGMFAEVAV 54 >U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse transcriptase protein. Length = 1049 Score = 22.6 bits (46), Expect = 10.0 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +2 Query: 368 EIVIYKNLQYRCVS 409 E+VIYKNL + C S Sbjct: 631 ELVIYKNLLHACRS 644 >DQ396551-1|ABD60146.1| 354|Anopheles gambiae adipokinetic hormone receptor protein. Length = 354 Score = 22.6 bits (46), Expect = 10.0 Identities = 10/37 (27%), Positives = 20/37 (54%) Frame = +3 Query: 177 ELYSFYSTGNASHLFTHLFVRVHFYDEFTYKDIFNVL 287 + + F+ G+ + V H+++E Y+ I+NVL Sbjct: 179 QAFIFHLEGHPNITGYQQCVTYHYFEEEIYQIIYNVL 215 >AY825592-1|AAV70203.1| 160|Anopheles gambiae cytochrome P450 protein. Length = 160 Score = 22.6 bits (46), Expect = 10.0 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +3 Query: 474 EIKKILRDHHDSTTAGHPGVARMLG 548 E+ I+ + HD+T AG V +LG Sbjct: 26 EVDTIMFEGHDTTAAGSSFVLCLLG 50 >AY825591-1|AAV70202.1| 160|Anopheles gambiae cytochrome P450 protein. Length = 160 Score = 22.6 bits (46), Expect = 10.0 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +3 Query: 474 EIKKILRDHHDSTTAGHPGVARMLG 548 E+ I+ + HD+T AG V +LG Sbjct: 26 EVDTIMFEGHDTTAAGSSFVLCLLG 50 >AY825590-1|AAV70201.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 22.6 bits (46), Expect = 10.0 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +3 Query: 474 EIKKILRDHHDSTTAGHPGVARMLG 548 E+ I+ + HD+T AG V +LG Sbjct: 37 EVDTIMFEGHDTTAAGSSFVLCLLG 61 >AY825589-1|AAV70200.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 22.6 bits (46), Expect = 10.0 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +3 Query: 474 EIKKILRDHHDSTTAGHPGVARMLG 548 E+ I+ + HD+T AG V +LG Sbjct: 37 EVDTIMFEGHDTTAAGSSFVLCLLG 61 >AY825588-1|AAV70199.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 22.6 bits (46), Expect = 10.0 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +3 Query: 474 EIKKILRDHHDSTTAGHPGVARMLG 548 E+ I+ + HD+T AG V +LG Sbjct: 37 EVDTIMFEGHDTTAAGSSFVLCLLG 61 >AY825587-1|AAV70198.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 22.6 bits (46), Expect = 10.0 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +3 Query: 474 EIKKILRDHHDSTTAGHPGVARMLG 548 E+ I+ + HD+T AG V +LG Sbjct: 37 EVDTIMFEGHDTTAAGSSFVLCLLG 61 >AY825586-1|AAV70197.1| 160|Anopheles gambiae cytochrome P450 protein. Length = 160 Score = 22.6 bits (46), Expect = 10.0 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +3 Query: 474 EIKKILRDHHDSTTAGHPGVARMLG 548 E+ I+ + HD+T AG V +LG Sbjct: 26 EVDTIMFEGHDTTAAGSSFVLCLLG 50 >AY825585-1|AAV70196.1| 160|Anopheles gambiae cytochrome P450 protein. Length = 160 Score = 22.6 bits (46), Expect = 10.0 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +3 Query: 474 EIKKILRDHHDSTTAGHPGVARMLG 548 E+ I+ + HD+T AG V +LG Sbjct: 26 EVDTIMFEGHDTTAAGSSFVLCLLG 50 >AY825584-1|AAV70195.1| 160|Anopheles gambiae cytochrome P450 protein. Length = 160 Score = 22.6 bits (46), Expect = 10.0 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +3 Query: 474 EIKKILRDHHDSTTAGHPGVARMLG 548 E+ I+ + HD+T AG V +LG Sbjct: 29 EVDTIMFEGHDTTAAGSSFVLCLLG 53 >AY825583-1|AAV70194.1| 160|Anopheles gambiae cytochrome P450 protein. Length = 160 Score = 22.6 bits (46), Expect = 10.0 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +3 Query: 474 EIKKILRDHHDSTTAGHPGVARMLG 548 E+ I+ + HD+T AG V +LG Sbjct: 29 EVDTIMFEGHDTTAAGSSFVLCLLG 53 >AY825582-1|AAV70193.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 22.6 bits (46), Expect = 10.0 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +3 Query: 474 EIKKILRDHHDSTTAGHPGVARMLG 548 E+ I+ + HD+T AG V +LG Sbjct: 37 EVDTIMFEGHDTTAAGSSFVLCLLG 61 >AY825581-1|AAV70192.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 22.6 bits (46), Expect = 10.0 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +3 Query: 474 EIKKILRDHHDSTTAGHPGVARMLG 548 E+ I+ + HD+T AG V +LG Sbjct: 37 EVDTIMFEGHDTTAAGSSFVLCLLG 61 >AY825580-1|AAV70191.1| 169|Anopheles gambiae cytochrome P450 protein. Length = 169 Score = 22.6 bits (46), Expect = 10.0 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +3 Query: 474 EIKKILRDHHDSTTAGHPGVARMLG 548 E+ I+ + HD+T AG V +LG Sbjct: 38 EVDTIMFEGHDTTAAGSSFVLCLLG 62 >AY825579-1|AAV70190.1| 169|Anopheles gambiae cytochrome P450 protein. Length = 169 Score = 22.6 bits (46), Expect = 10.0 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +3 Query: 474 EIKKILRDHHDSTTAGHPGVARMLG 548 E+ I+ + HD+T AG V +LG Sbjct: 38 EVDTIMFEGHDTTAAGSSFVLCLLG 62 >AY825578-1|AAV70189.1| 171|Anopheles gambiae cytochrome P450 protein. Length = 171 Score = 22.6 bits (46), Expect = 10.0 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +3 Query: 474 EIKKILRDHHDSTTAGHPGVARMLG 548 E+ I+ + HD+T AG V +LG Sbjct: 40 EVDTIMFEGHDTTAAGSSFVLCLLG 64 >AY825577-1|AAV70188.1| 171|Anopheles gambiae cytochrome P450 protein. Length = 171 Score = 22.6 bits (46), Expect = 10.0 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +3 Query: 474 EIKKILRDHHDSTTAGHPGVARMLG 548 E+ I+ + HD+T AG V +LG Sbjct: 40 EVDTIMFEGHDTTAAGSSFVLCLLG 64 >AY825576-1|AAV70187.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 22.6 bits (46), Expect = 10.0 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +3 Query: 474 EIKKILRDHHDSTTAGHPGVARMLG 548 E+ I+ + HD+T AG V +LG Sbjct: 37 EVDTIMFEGHDTTAAGSSFVLCLLG 61 >AY825575-1|AAV70186.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 22.6 bits (46), Expect = 10.0 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +3 Query: 474 EIKKILRDHHDSTTAGHPGVARMLG 548 E+ I+ + HD+T AG V +LG Sbjct: 37 EVDTIMFEGHDTTAAGSSFVLCLLG 61 >AY825574-1|AAV70185.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 22.6 bits (46), Expect = 10.0 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +3 Query: 474 EIKKILRDHHDSTTAGHPGVARMLG 548 E+ I+ + HD+T AG V +LG Sbjct: 37 EVDTIMFEGHDTTAAGSSFVLCLLG 61 >AY825573-1|AAV70184.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 22.6 bits (46), Expect = 10.0 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +3 Query: 474 EIKKILRDHHDSTTAGHPGVARMLG 548 E+ I+ + HD+T AG V +LG Sbjct: 37 EVDTIMFEGHDTTAAGSSFVLCLLG 61 >AY825572-1|AAV70183.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 22.6 bits (46), Expect = 10.0 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +3 Query: 474 EIKKILRDHHDSTTAGHPGVARMLG 548 E+ I+ + HD+T AG V +LG Sbjct: 37 EVDTIMFEGHDTTAAGSSFVLCLLG 61 >AY825571-1|AAV70182.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 22.6 bits (46), Expect = 10.0 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +3 Query: 474 EIKKILRDHHDSTTAGHPGVARMLG 548 E+ I+ + HD+T AG V +LG Sbjct: 37 EVDTIMFEGHDTTAAGSSFVLCLLG 61 >AY825570-1|AAV70181.1| 157|Anopheles gambiae cytochrome P450 protein. Length = 157 Score = 22.6 bits (46), Expect = 10.0 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +3 Query: 474 EIKKILRDHHDSTTAGHPGVARMLG 548 E+ I+ + HD+T AG V +LG Sbjct: 26 EVDTIMFEGHDTTAAGSSFVLCLLG 50 >AY825569-1|AAV70180.1| 157|Anopheles gambiae cytochrome P450 protein. Length = 157 Score = 22.6 bits (46), Expect = 10.0 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +3 Query: 474 EIKKILRDHHDSTTAGHPGVARMLG 548 E+ I+ + HD+T AG V +LG Sbjct: 26 EVDTIMFEGHDTTAAGSSFVLCLLG 50 >AY825568-1|AAV70179.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 22.6 bits (46), Expect = 10.0 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +3 Query: 474 EIKKILRDHHDSTTAGHPGVARMLG 548 E+ I+ + HD+T AG V +LG Sbjct: 40 EVDTIMFEGHDTTAAGSSFVLCLLG 64 >AY825567-1|AAV70178.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 22.6 bits (46), Expect = 10.0 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +3 Query: 474 EIKKILRDHHDSTTAGHPGVARMLG 548 E+ I+ + HD+T AG V +LG Sbjct: 40 EVDTIMFEGHDTTAAGSSFVLCLLG 64 >AY825566-1|AAV70177.1| 173|Anopheles gambiae cytochrome P450 protein. Length = 173 Score = 22.6 bits (46), Expect = 10.0 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +3 Query: 474 EIKKILRDHHDSTTAGHPGVARMLG 548 E+ I+ + HD+T AG V +LG Sbjct: 38 EVDTIMFEGHDTTAAGSSFVLCLLG 62 >AY825565-1|AAV70176.1| 173|Anopheles gambiae cytochrome P450 protein. Length = 173 Score = 22.6 bits (46), Expect = 10.0 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +3 Query: 474 EIKKILRDHHDSTTAGHPGVARMLG 548 E+ I+ + HD+T AG V +LG Sbjct: 38 EVDTIMFEGHDTTAAGSSFVLCLLG 62 >AY825564-1|AAV70175.1| 175|Anopheles gambiae cytochrome P450 protein. Length = 175 Score = 22.6 bits (46), Expect = 10.0 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +3 Query: 474 EIKKILRDHHDSTTAGHPGVARMLG 548 E+ I+ + HD+T AG V +LG Sbjct: 40 EVDTIMFEGHDTTAAGSSFVLCLLG 64 >AY825563-1|AAV70174.1| 175|Anopheles gambiae cytochrome P450 protein. Length = 175 Score = 22.6 bits (46), Expect = 10.0 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +3 Query: 474 EIKKILRDHHDSTTAGHPGVARMLG 548 E+ I+ + HD+T AG V +LG Sbjct: 40 EVDTIMFEGHDTTAAGSSFVLCLLG 64 >AY825562-1|AAV70173.1| 166|Anopheles gambiae cytochrome P450 protein. Length = 166 Score = 22.6 bits (46), Expect = 10.0 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +3 Query: 474 EIKKILRDHHDSTTAGHPGVARMLG 548 E+ I+ + HD+T AG V +LG Sbjct: 37 EVDTIMFEGHDTTAAGSSFVLCLLG 61 >AY825561-1|AAV70172.1| 166|Anopheles gambiae cytochrome P450 protein. Length = 166 Score = 22.6 bits (46), Expect = 10.0 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +3 Query: 474 EIKKILRDHHDSTTAGHPGVARMLG 548 E+ I+ + HD+T AG V +LG Sbjct: 37 EVDTIMFEGHDTTAAGSSFVLCLLG 61 >AY825560-1|AAV70171.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 22.6 bits (46), Expect = 10.0 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +3 Query: 474 EIKKILRDHHDSTTAGHPGVARMLG 548 E+ I+ + HD+T AG V +LG Sbjct: 37 EVDTIMFEGHDTTAAGSSFVLCLLG 61 >AY825559-1|AAV70170.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 22.6 bits (46), Expect = 10.0 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +3 Query: 474 EIKKILRDHHDSTTAGHPGVARMLG 548 E+ I+ + HD+T AG V +LG Sbjct: 37 EVDTIMFEGHDTTAAGSSFVLCLLG 61 >AY825558-1|AAV70169.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 22.6 bits (46), Expect = 10.0 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +3 Query: 474 EIKKILRDHHDSTTAGHPGVARMLG 548 E+ I+ + HD+T AG V +LG Sbjct: 37 EVDTIMFEGHDTTAAGSSFVLCLLG 61 >AY825557-1|AAV70168.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 22.6 bits (46), Expect = 10.0 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +3 Query: 474 EIKKILRDHHDSTTAGHPGVARMLG 548 E+ I+ + HD+T AG V +LG Sbjct: 37 EVDTIMFEGHDTTAAGSSFVLCLLG 61 >AY825556-1|AAV70167.1| 170|Anopheles gambiae cytochrome P450 protein. Length = 170 Score = 22.6 bits (46), Expect = 10.0 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +3 Query: 474 EIKKILRDHHDSTTAGHPGVARMLG 548 E+ I+ + HD+T AG V +LG Sbjct: 38 EVDTIMFEGHDTTAAGSSFVLCLLG 62 >AY825555-1|AAV70166.1| 170|Anopheles gambiae cytochrome P450 protein. Length = 170 Score = 22.6 bits (46), Expect = 10.0 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +3 Query: 474 EIKKILRDHHDSTTAGHPGVARMLG 548 E+ I+ + HD+T AG V +LG Sbjct: 38 EVDTIMFEGHDTTAAGSSFVLCLLG 62 >AY825554-1|AAV70165.1| 156|Anopheles gambiae cytochrome P450 protein. Length = 156 Score = 22.6 bits (46), Expect = 10.0 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +3 Query: 474 EIKKILRDHHDSTTAGHPGVARMLG 548 E+ I+ + HD+T AG V +LG Sbjct: 25 EVDTIMFEGHDTTAAGSSFVLCLLG 49 >AY825553-1|AAV70164.1| 156|Anopheles gambiae cytochrome P450 protein. Length = 156 Score = 22.6 bits (46), Expect = 10.0 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +3 Query: 474 EIKKILRDHHDSTTAGHPGVARMLG 548 E+ I+ + HD+T AG V +LG Sbjct: 25 EVDTIMFEGHDTTAAGSSFVLCLLG 49 >AY825552-1|AAV70163.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 22.6 bits (46), Expect = 10.0 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +3 Query: 474 EIKKILRDHHDSTTAGHPGVARMLG 548 E+ I+ + HD+T AG V +LG Sbjct: 37 EVDTIMFEGHDTTAAGSSFVLCLLG 61 >AY825551-1|AAV70162.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 22.6 bits (46), Expect = 10.0 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +3 Query: 474 EIKKILRDHHDSTTAGHPGVARMLG 548 E+ I+ + HD+T AG V +LG Sbjct: 37 EVDTIMFEGHDTTAAGSSFVLCLLG 61 >AY825550-1|AAV70161.1| 166|Anopheles gambiae cytochrome P450 protein. Length = 166 Score = 22.6 bits (46), Expect = 10.0 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +3 Query: 474 EIKKILRDHHDSTTAGHPGVARMLG 548 E+ I+ + HD+T AG V +LG Sbjct: 38 EVDTIMFEGHDTTAAGSSFVLCLLG 62 >AY825549-1|AAV70160.1| 166|Anopheles gambiae cytochrome P450 protein. Length = 166 Score = 22.6 bits (46), Expect = 10.0 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +3 Query: 474 EIKKILRDHHDSTTAGHPGVARMLG 548 E+ I+ + HD+T AG V +LG Sbjct: 38 EVDTIMFEGHDTTAAGSSFVLCLLG 62 >AY825548-1|AAV70159.1| 173|Anopheles gambiae cytochrome P450 protein. Length = 173 Score = 22.6 bits (46), Expect = 10.0 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +3 Query: 474 EIKKILRDHHDSTTAGHPGVARMLG 548 E+ I+ + HD+T AG V +LG Sbjct: 38 EVDTIMFEGHDTTAAGSSFVLCLLG 62 >AY825547-1|AAV70158.1| 173|Anopheles gambiae cytochrome P450 protein. Length = 173 Score = 22.6 bits (46), Expect = 10.0 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +3 Query: 474 EIKKILRDHHDSTTAGHPGVARMLG 548 E+ I+ + HD+T AG V +LG Sbjct: 38 EVDTIMFEGHDTTAAGSSFVLCLLG 62 >AY825546-1|AAV70157.1| 170|Anopheles gambiae cytochrome P450 protein. Length = 170 Score = 22.6 bits (46), Expect = 10.0 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +3 Query: 474 EIKKILRDHHDSTTAGHPGVARMLG 548 E+ I+ + HD+T AG V +LG Sbjct: 39 EVDTIMFEGHDTTAAGSSFVLCLLG 63 >AY825545-1|AAV70156.1| 170|Anopheles gambiae cytochrome P450 protein. Length = 170 Score = 22.6 bits (46), Expect = 10.0 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +3 Query: 474 EIKKILRDHHDSTTAGHPGVARMLG 548 E+ I+ + HD+T AG V +LG Sbjct: 39 EVDTIMFEGHDTTAAGSSFVLCLLG 63 >AY825544-1|AAV70155.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 22.6 bits (46), Expect = 10.0 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +3 Query: 474 EIKKILRDHHDSTTAGHPGVARMLG 548 E+ I+ + HD+T AG V +LG Sbjct: 37 EVDTIMFEGHDTTAAGSSFVLCLLG 61 >AY825543-1|AAV70154.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 22.6 bits (46), Expect = 10.0 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +3 Query: 474 EIKKILRDHHDSTTAGHPGVARMLG 548 E+ I+ + HD+T AG V +LG Sbjct: 37 EVDTIMFEGHDTTAAGSSFVLCLLG 61 >AY298745-1|AAQ63187.1| 354|Anopheles gambiae G-protein coupled receptor protein. Length = 354 Score = 22.6 bits (46), Expect = 10.0 Identities = 10/37 (27%), Positives = 20/37 (54%) Frame = +3 Query: 177 ELYSFYSTGNASHLFTHLFVRVHFYDEFTYKDIFNVL 287 + + F+ G+ + V H+++E Y+ I+NVL Sbjct: 179 QAFIFHLEGHPNITGYQQCVTYHYFEEEIYQIIYNVL 215 >AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodium channel alpha subunitprotein. Length = 2139 Score = 22.6 bits (46), Expect = 10.0 Identities = 9/39 (23%), Positives = 18/39 (46%) Frame = +1 Query: 178 NCTHFILPVTPVIYLHICLSVFIFTTSLRIKIFLMFYVV 294 NC I+P TP + + I+T +K+ +++ Sbjct: 165 NCILMIMPTTPTVESTEVIFTGIYTFESAVKVMARGFIL 203 >AJ970250-1|CAI96722.1| 132|Anopheles gambiae putative reverse transcriptase protein. Length = 132 Score = 22.6 bits (46), Expect = 10.0 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = +2 Query: 368 EIVIYKNLQYRCVS 409 E+VIY NL Y C S Sbjct: 16 ELVIYNNLLYACRS 29 >AJ010299-1|CAA09070.1| 722|Anopheles gambiae stat protein. Length = 722 Score = 22.6 bits (46), Expect = 10.0 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = +2 Query: 518 RSPRSRSYVRTNKRTILV 571 + PRS+ Y+ RT+L+ Sbjct: 646 QKPRSKHYISAEMRTVLI 663 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 623,377 Number of Sequences: 2352 Number of extensions: 12913 Number of successful extensions: 125 Number of sequences better than 10.0: 61 Number of HSP's better than 10.0 without gapping: 124 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 125 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 58029966 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -