BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0298 (690 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_03_1278 - 25413432-25413652,25413678-25413769,25413944-25414146 29 2.6 06_02_0214 + 13141213-13143741 29 3.5 02_02_0218 - 7975237-7975934,7976896-7977721 28 8.0 01_06_1758 - 39681942-39682030,39682115-39682345,39682643-396826... 28 8.0 >07_03_1278 - 25413432-25413652,25413678-25413769,25413944-25414146 Length = 171 Score = 29.5 bits (63), Expect = 2.6 Identities = 14/47 (29%), Positives = 23/47 (48%), Gaps = 1/47 (2%) Frame = +2 Query: 50 LSQLDHSFRSFVRNFVQTIDVSRVFR*PSEFIVHHNGK-TIVSCARF 187 L L H + NFV ++ F ++FI+HHN +++ C F Sbjct: 84 LDPLSHEEFLHMSNFVSSLYAVNSFTSEAKFIIHHNSNFSLIICTEF 130 >06_02_0214 + 13141213-13143741 Length = 842 Score = 29.1 bits (62), Expect = 3.5 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = +3 Query: 234 ACSSNVNPLCNDPFNIRIDTGNSYLFRLENCD 329 A S+ N L N + +D+G SYL R CD Sbjct: 284 AASNTTNALFNMTWQFDVDSGFSYLIRFHFCD 315 >02_02_0218 - 7975237-7975934,7976896-7977721 Length = 507 Score = 27.9 bits (59), Expect = 8.0 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = +3 Query: 51 SANWITRFGHSFAISCKR*TSLVFSDN 131 ++ W+T+FG S + TSLV DN Sbjct: 226 NSTWVTKFGRSAFLRAGNATSLVIEDN 252 >01_06_1758 - 39681942-39682030,39682115-39682345,39682643-39682679, 39683604-39683835,39683937-39684022,39684126-39684218, 39684302-39684465,39684541-39684702,39684783-39684962, 39685079-39685515,39685614-39685669 Length = 588 Score = 27.9 bits (59), Expect = 8.0 Identities = 12/33 (36%), Positives = 21/33 (63%) Frame = -2 Query: 317 EAEQIRIPGVDTDIKRIVAQRIHVRRTRPTIHW 219 EA+++ G + I++IVAQ +R R T++W Sbjct: 311 EADRMLDMGFEPQIRKIVAQAWLIRPDRQTLYW 343 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,820,814 Number of Sequences: 37544 Number of extensions: 317109 Number of successful extensions: 823 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 805 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 823 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1756684372 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -