BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0294 (610 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_57837| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_49794| Best HMM Match : CBS (HMM E-Value=2.8) 27 9.0 >SB_57837| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 551 Score = 49.2 bits (112), Expect = 3e-06 Identities = 26/59 (44%), Positives = 32/59 (54%) Frame = +2 Query: 311 LQKRLAKGQKFFDSGDYQMAKQRPGNXXXXXXXXXXXXXXXTGDAIPTPETVPLRKTSI 487 ++KRL K K+FDSGDY MAK R N G IPTP+ +P RKTS+ Sbjct: 58 MRKRLQKRVKYFDSGDYMMAKSRDKN----PRGPVNPAVLAVGKGIPTPDKIPHRKTSV 112 >SB_49794| Best HMM Match : CBS (HMM E-Value=2.8) Length = 120 Score = 27.5 bits (58), Expect = 9.0 Identities = 17/38 (44%), Positives = 22/38 (57%), Gaps = 1/38 (2%) Frame = +2 Query: 278 LGRGPSGHSAFLQKRLA-KGQKFFDSGDYQMAKQRPGN 388 LGR SG + + RLA +G+K+ DS D KQ P N Sbjct: 53 LGR-LSGVVSLKELRLAIEGEKYLDSADVNNTKQGPAN 89 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,195,647 Number of Sequences: 59808 Number of extensions: 255831 Number of successful extensions: 437 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 398 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 436 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1487884875 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -