BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0293 (718 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT010077-1|AAQ22546.1| 924|Drosophila melanogaster LD09801p pro... 30 2.7 AE013599-1997|AAM68542.1| 924|Drosophila melanogaster CG12424-P... 30 2.7 AE013599-1996|AAM68541.1| 924|Drosophila melanogaster CG12424-P... 30 2.7 AE013599-1995|AAF58176.1| 924|Drosophila melanogaster CG12424-P... 30 2.7 >BT010077-1|AAQ22546.1| 924|Drosophila melanogaster LD09801p protein. Length = 924 Score = 30.3 bits (65), Expect = 2.7 Identities = 14/39 (35%), Positives = 24/39 (61%) Frame = +2 Query: 125 RPIIAHYLNGKVQGNEQVYCEKYYKPHVTSYVPAIYTLP 241 +PI A+Y + Q +++CEKY+ TS + +I T+P Sbjct: 721 QPIYANYATIQ-QTTAEIHCEKYHDSKSTSSIDSIDTIP 758 >AE013599-1997|AAM68542.1| 924|Drosophila melanogaster CG12424-PC, isoform C protein. Length = 924 Score = 30.3 bits (65), Expect = 2.7 Identities = 14/39 (35%), Positives = 24/39 (61%) Frame = +2 Query: 125 RPIIAHYLNGKVQGNEQVYCEKYYKPHVTSYVPAIYTLP 241 +PI A+Y + Q +++CEKY+ TS + +I T+P Sbjct: 721 QPIYANYATIQ-QTTAEIHCEKYHDSKSTSSIDSIDTIP 758 >AE013599-1996|AAM68541.1| 924|Drosophila melanogaster CG12424-PB, isoform B protein. Length = 924 Score = 30.3 bits (65), Expect = 2.7 Identities = 14/39 (35%), Positives = 24/39 (61%) Frame = +2 Query: 125 RPIIAHYLNGKVQGNEQVYCEKYYKPHVTSYVPAIYTLP 241 +PI A+Y + Q +++CEKY+ TS + +I T+P Sbjct: 721 QPIYANYATIQ-QTTAEIHCEKYHDSKSTSSIDSIDTIP 758 >AE013599-1995|AAF58176.1| 924|Drosophila melanogaster CG12424-PA, isoform A protein. Length = 924 Score = 30.3 bits (65), Expect = 2.7 Identities = 14/39 (35%), Positives = 24/39 (61%) Frame = +2 Query: 125 RPIIAHYLNGKVQGNEQVYCEKYYKPHVTSYVPAIYTLP 241 +PI A+Y + Q +++CEKY+ TS + +I T+P Sbjct: 721 QPIYANYATIQ-QTTAEIHCEKYHDSKSTSSIDSIDTIP 758 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 27,951,902 Number of Sequences: 53049 Number of extensions: 517478 Number of successful extensions: 844 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 824 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 844 length of database: 24,988,368 effective HSP length: 83 effective length of database: 20,585,301 effective search space used: 3190721655 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -