BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0292 (752 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 24 1.3 DQ011226-1|AAY63895.1| 471|Apis mellifera Rh-like protein protein. 22 7.1 AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. 21 9.4 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 24.2 bits (50), Expect = 1.3 Identities = 13/49 (26%), Positives = 19/49 (38%) Frame = +2 Query: 284 DGSWSDCGACPRGFRTNASSYCMPCVDEPSLYDWQYLGFMVLLPMVLHW 430 D +++C P FR MPC PS + F+ + L W Sbjct: 290 DYGFTECRCDPGYFRAEKDPKKMPCTQPPSAPQNLTVNFVDQSTVFLSW 338 >DQ011226-1|AAY63895.1| 471|Apis mellifera Rh-like protein protein. Length = 471 Score = 21.8 bits (44), Expect = 7.1 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -3 Query: 63 YKFYNSLIPKLLKVPAARGIH 1 YK+ LI K LK+ G+H Sbjct: 312 YKYITPLIQKHLKIHDTCGVH 332 >AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. Length = 493 Score = 21.4 bits (43), Expect = 9.4 Identities = 6/16 (37%), Positives = 9/16 (56%) Frame = -3 Query: 267 PQYSPGHDLTAAIL*W 220 P ++PGHD + W Sbjct: 24 PHFAPGHDAIVHLFEW 39 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 198,782 Number of Sequences: 438 Number of extensions: 3884 Number of successful extensions: 6 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23632110 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -