BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0280 (420 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AE013599-3970|AAM70795.2| 126|Drosophila melanogaster CG30423-P... 72 3e-13 BT001754-1|AAN71509.1| 126|Drosophila melanogaster RH04491p pro... 70 1e-12 >AE013599-3970|AAM70795.2| 126|Drosophila melanogaster CG30423-PB protein. Length = 126 Score = 72.1 bits (169), Expect = 3e-13 Identities = 33/58 (56%), Positives = 43/58 (74%) Frame = +1 Query: 196 MAGIKGLVSLAFAGSIGMTFVILACALPQYKLWWPFFVVLFYILCPIPTMIARRHTDG 369 MA +KGL AF IG+TF+ILACA+P K+++PFFV+LFY+L +P IARR T G Sbjct: 1 MATLKGLFICAFLTCIGVTFLILACAVPTTKIFYPFFVLLFYVLSVLPVFIARRTTPG 58 >BT001754-1|AAN71509.1| 126|Drosophila melanogaster RH04491p protein. Length = 126 Score = 69.7 bits (163), Expect = 1e-12 Identities = 32/58 (55%), Positives = 42/58 (72%) Frame = +1 Query: 196 MAGIKGLVSLAFAGSIGMTFVILACALPQYKLWWPFFVVLFYILCPIPTMIARRHTDG 369 MA +K L AF IG+TF+ILACA+P K+++PFFV+LFY+L +P IARR T G Sbjct: 1 MATLKALFICAFLTCIGVTFLILACAVPTTKIFYPFFVLLFYVLSVLPVFIARRTTPG 58 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,795,700 Number of Sequences: 53049 Number of extensions: 348812 Number of successful extensions: 621 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 618 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 621 length of database: 24,988,368 effective HSP length: 78 effective length of database: 20,850,546 effective search space used: 1271883306 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -