BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0280 (420 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g11530.2 68416.m01406 vacuolar protein sorting 55 family prot... 41 3e-04 At1g32410.2 68414.m04000 vacuolar protein sorting 55 family prot... 41 4e-04 At1g32410.1 68414.m03999 vacuolar protein sorting 55 family prot... 41 4e-04 At3g11530.1 68416.m01405 vacuolar protein sorting 55 family prot... 35 0.026 At3g26780.1 68416.m03350 phosphoglycerate/bisphosphoglycerate mu... 28 2.2 At1g80460.1 68414.m09423 glycerol kinase, putative similar to gl... 28 2.2 At5g47050.1 68418.m05798 expressed protein 28 3.0 At3g14330.1 68416.m01812 pentatricopeptide (PPR) repeat-containi... 27 3.9 At4g34810.1 68417.m04940 auxin-responsive family protein similar... 27 6.8 At4g17680.1 68417.m02641 expressed protein 26 9.0 At1g21940.1 68414.m02745 hypothetical protein 26 9.0 >At3g11530.2 68416.m01406 vacuolar protein sorting 55 family protein / VPS55 family protein contains Pfam domain PF04133: Vacuolar protein sorting 55 Length = 126 Score = 41.1 bits (92), Expect = 3e-04 Identities = 20/47 (42%), Positives = 26/47 (55%) Frame = +1 Query: 205 IKGLVSLAFAGSIGMTFVILACALPQYKLWWPFFVVLFYILCPIPTM 345 I+ L LAF S + ILACA+ Y WWP L Y++ P+P M Sbjct: 5 IEVLAGLAFMFSSSILLQILACAI--YGNWWPMLSALMYVVVPMPCM 49 >At1g32410.2 68414.m04000 vacuolar protein sorting 55 family protein / VPS55 family protein contains Pfam domain PF04133: Vacuolar protein sorting 55 Length = 140 Score = 40.7 bits (91), Expect = 4e-04 Identities = 23/67 (34%), Positives = 34/67 (50%), Gaps = 2/67 (2%) Frame = +1 Query: 223 LAFAGSIGMTFVILACALPQYKLWWPFFVVLFYILCPIPTMI--ARRHTDGAGGSNSACM 396 LA S G+ ILACAL + WWP V+ Y+L P+P + T S+++ + Sbjct: 20 LAILVSTGIVLQILACAL--FNNWWPMLSVIMYVLLPMPLLFFGGSDSTSLFNESDNSWI 77 Query: 397 ETAVFIT 417 A F+T Sbjct: 78 NAAKFLT 84 >At1g32410.1 68414.m03999 vacuolar protein sorting 55 family protein / VPS55 family protein contains Pfam domain PF04133: Vacuolar protein sorting 55 Length = 140 Score = 40.7 bits (91), Expect = 4e-04 Identities = 23/67 (34%), Positives = 34/67 (50%), Gaps = 2/67 (2%) Frame = +1 Query: 223 LAFAGSIGMTFVILACALPQYKLWWPFFVVLFYILCPIPTMI--ARRHTDGAGGSNSACM 396 LA S G+ ILACAL + WWP V+ Y+L P+P + T S+++ + Sbjct: 20 LAILVSTGIVLQILACAL--FNNWWPMLSVIMYVLLPMPLLFFGGSDSTSLFNESDNSWI 77 Query: 397 ETAVFIT 417 A F+T Sbjct: 78 NAAKFLT 84 >At3g11530.1 68416.m01405 vacuolar protein sorting 55 family protein / VPS55 family protein contains Pfam domain PF04133: Vacuolar protein sorting 55 Length = 113 Score = 34.7 bits (76), Expect = 0.026 Identities = 14/29 (48%), Positives = 18/29 (62%) Frame = +1 Query: 259 ILACALPQYKLWWPFFVVLFYILCPIPTM 345 ILACA+ Y WWP L Y++ P+P M Sbjct: 10 ILACAI--YGNWWPMLSALMYVVVPMPCM 36 >At3g26780.1 68416.m03350 phosphoglycerate/bisphosphoglycerate mutase family protein similar to X4 protein GI:21386798, Y4 protein GI:21386800 from [Silene dioica]; contains Pfam profiles PF00300: phosphoglycerate mutase family, PF01535: PPR repeat Length = 1053 Score = 28.3 bits (60), Expect = 2.2 Identities = 13/40 (32%), Positives = 23/40 (57%) Frame = +3 Query: 141 ISGVFKQEENNYT*NIKHNGWNKRFGVVGIRGFNWNDICH 260 +SGV ++ ++Y+ HN ++R G V + NW D+ H Sbjct: 250 VSGVAEKLRSDYSSTTNHNETHERDGGVSLASTNW-DLLH 288 >At1g80460.1 68414.m09423 glycerol kinase, putative similar to glycerol kinase (ATP:glycerol 3-phosphotransferase, Glycerokinase, GK)[Mycobacterium tuberculosis] Swiss-Prot:O69664 Length = 522 Score = 28.3 bits (60), Expect = 2.2 Identities = 16/43 (37%), Positives = 22/43 (51%) Frame = +2 Query: 254 LSY*LVPYHNTNYGGHSSLCYSTFCAQYLR*SLGGILMVLEVQ 382 L+Y L P TNY S+ + Q+LR SLG I E++ Sbjct: 299 LAYKLGPQAQTNYALEGSIAIAGAAVQWLRDSLGIIKSASEIE 341 >At5g47050.1 68418.m05798 expressed protein Length = 300 Score = 27.9 bits (59), Expect = 3.0 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = -3 Query: 337 VLGTECRIAQRRMATIVCIVVRH 269 ++G CRI +RR AT++ + RH Sbjct: 248 MIGPGCRICRRRSATVLALPCRH 270 >At3g14330.1 68416.m01812 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 710 Score = 27.5 bits (58), Expect = 3.9 Identities = 14/51 (27%), Positives = 25/51 (49%), Gaps = 2/51 (3%) Frame = +3 Query: 78 LIKVKGKTKQIIYYLLAEVYFISGVFKQEENNYT*NIKHN--GWNKRFGVV 224 ++K K K Q++Y +L ++Y SG+F + + N WN V+ Sbjct: 262 IVKRKEKVDQVVYNVLLKLYMESGLFDDARKVFDGMSERNVVTWNSLISVL 312 >At4g34810.1 68417.m04940 auxin-responsive family protein similar to auxin-induced protein X10A5 (SP:P33079) [Glycine max]; small auxin up RNA (SAUR-AC1), Arabidopsis thaliana, PIR2:T06084 Length = 105 Score = 26.6 bits (56), Expect = 6.8 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -3 Query: 103 FVFPFTFINHPSHKRSL 53 FV P +F+NHPS K L Sbjct: 55 FVVPISFLNHPSFKEFL 71 >At4g17680.1 68417.m02641 expressed protein Length = 314 Score = 26.2 bits (55), Expect = 9.0 Identities = 8/26 (30%), Positives = 18/26 (69%) Frame = -3 Query: 337 VLGTECRIAQRRMATIVCIVVRHKLV 260 ++G CRI +R+ AT++ + +H ++ Sbjct: 262 LIGPSCRICRRKSATVMALPCQHLIL 287 >At1g21940.1 68414.m02745 hypothetical protein Length = 183 Score = 26.2 bits (55), Expect = 9.0 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = -2 Query: 311 TTKNGHHSLYCGKAQASMTNV 249 TTKNGH +LYC M ++ Sbjct: 106 TTKNGHVALYCASELNKMADM 126 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,925,674 Number of Sequences: 28952 Number of extensions: 165429 Number of successful extensions: 319 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 313 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 316 length of database: 12,070,560 effective HSP length: 74 effective length of database: 9,928,112 effective search space used: 645327280 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -