BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0262 (709 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodi... 25 2.3 AY705401-1|AAU12510.1| 490|Anopheles gambiae nicotinic acetylch... 25 3.1 AY705400-1|AAU12509.1| 490|Anopheles gambiae nicotinic acetylch... 25 3.1 AY705399-1|AAU12508.1| 533|Anopheles gambiae nicotinic acetylch... 24 4.1 U28809-1|AAC47326.1| 140|Anopheles gambiae lysozyme protein. 23 9.4 DQ007317-1|AAY24699.1| 140|Anopheles gambiae lysozyme c-1 protein. 23 9.4 AY705402-1|AAU12511.1| 509|Anopheles gambiae nicotinic acetylch... 23 9.4 >AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodium channel alpha subunitprotein. Length = 2139 Score = 25.0 bits (52), Expect = 2.3 Identities = 13/31 (41%), Positives = 20/31 (64%) Frame = +3 Query: 336 RPLIFSIIIRYYYDVYIKTELFFFILLLKWV 428 RP++ I+ YY D I T +FF +L+KW+ Sbjct: 1332 RPILQDIL--YYMD-RIFTVIFFLEMLIKWL 1359 >AY705401-1|AAU12510.1| 490|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 6 protein. Length = 490 Score = 24.6 bits (51), Expect = 3.1 Identities = 14/42 (33%), Positives = 18/42 (42%) Frame = +1 Query: 388 KRNFFSSYCC*SGYFQFLCKIYISNRLNTYFFKRRKHLLEPC 513 K+N + CC Y I I R YFF +L+ PC Sbjct: 205 KKNTITYQCCPEPYVDITFTIQIRRRTLYYFF----NLIVPC 242 >AY705400-1|AAU12509.1| 490|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 6 protein. Length = 490 Score = 24.6 bits (51), Expect = 3.1 Identities = 14/42 (33%), Positives = 18/42 (42%) Frame = +1 Query: 388 KRNFFSSYCC*SGYFQFLCKIYISNRLNTYFFKRRKHLLEPC 513 K+N + CC Y I I R YFF +L+ PC Sbjct: 205 KKNTITYQCCPEPYVDITFTIQIRRRTLYYFF----NLIVPC 242 >AY705399-1|AAU12508.1| 533|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 5 protein. Length = 533 Score = 24.2 bits (50), Expect = 4.1 Identities = 15/42 (35%), Positives = 17/42 (40%) Frame = +1 Query: 388 KRNFFSSYCC*SGYFQFLCKIYISNRLNTYFFKRRKHLLEPC 513 KRN CC Y I I R YFF +L+ PC Sbjct: 220 KRNEIYYNCCPEPYIDITFAIIIRRRTLYYFF----NLIVPC 257 >U28809-1|AAC47326.1| 140|Anopheles gambiae lysozyme protein. Length = 140 Score = 23.0 bits (47), Expect = 9.4 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +1 Query: 403 SSYCC*SGYFQFLCKIYISNRLN 471 + Y C SGY CKI N LN Sbjct: 77 NKYWCDSGYGSNDCKIACKNLLN 99 >DQ007317-1|AAY24699.1| 140|Anopheles gambiae lysozyme c-1 protein. Length = 140 Score = 23.0 bits (47), Expect = 9.4 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +1 Query: 403 SSYCC*SGYFQFLCKIYISNRLN 471 + Y C SGY CKI N LN Sbjct: 77 NKYWCDSGYGSNDCKIACKNLLN 99 >AY705402-1|AAU12511.1| 509|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 7 protein. Length = 509 Score = 23.0 bits (47), Expect = 9.4 Identities = 14/42 (33%), Positives = 17/42 (40%) Frame = +1 Query: 388 KRNFFSSYCC*SGYFQFLCKIYISNRLNTYFFKRRKHLLEPC 513 KRN CC Y I I + YFF +L+ PC Sbjct: 188 KRNEIYYNCCPEPYIDITFAILIRRKTLYYFF----NLIVPC 225 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 663,723 Number of Sequences: 2352 Number of extensions: 13536 Number of successful extensions: 22 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 72340815 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -