BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0259 (438 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protei... 21 4.5 DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholi... 21 5.9 AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-act... 21 5.9 >AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protein kinase foraging protein. Length = 678 Score = 21.4 bits (43), Expect = 4.5 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +3 Query: 198 RQSGPGDRGPR 230 R GPG +GPR Sbjct: 56 RNPGPGSKGPR 66 >DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholine receptor beta2subunit protein. Length = 427 Score = 21.0 bits (42), Expect = 5.9 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = +3 Query: 378 NLKXISAKVFLVINVIL 428 N+K I +F++INV+L Sbjct: 3 NMKNIFPVLFVIINVLL 19 >AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-activated ion channelvariant L protein. Length = 664 Score = 21.0 bits (42), Expect = 5.9 Identities = 13/35 (37%), Positives = 20/35 (57%), Gaps = 3/35 (8%) Frame = -2 Query: 236 AEPRTSIAGPALTMPSR---MFLPIFSIFLKIFHL 141 AE R S + P R +FL + S+F++IF+L Sbjct: 248 AEGRLSSDNMSKKSPVRKATLFLNMASVFMRIFNL 282 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 114,717 Number of Sequences: 438 Number of extensions: 2200 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 11327868 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -