BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0256 (383 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory recept... 22 2.4 AJ845189-1|CAH60166.1| 515|Tribolium castaneum putative esteras... 20 7.4 AJ845188-1|CAH60165.1| 517|Tribolium castaneum putative esteras... 20 7.4 AJ845187-1|CAH60164.1| 515|Tribolium castaneum esterase protein. 20 7.4 AJ844897-1|CAH59956.1| 517|Tribolium castaneum esterase protein. 20 7.4 >AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory receptor candidate 61 protein. Length = 670 Score = 21.8 bits (44), Expect = 2.4 Identities = 12/47 (25%), Positives = 18/47 (38%) Frame = -2 Query: 193 LNLLKFNPTFNKPTINKLGLAPCYGRWKLKI*FRTTLHAAVLPQLCV 53 L + T PT LGL P G + + T + ++ Q V Sbjct: 617 LQIFALQLTHRAPTFTALGLFPINGSFAFTVVGAATTYITIIYQFQV 663 >AJ845189-1|CAH60166.1| 515|Tribolium castaneum putative esterase protein. Length = 515 Score = 20.2 bits (40), Expect = 7.4 Identities = 7/19 (36%), Positives = 12/19 (63%) Frame = -2 Query: 379 HFYNFHTNAHFMNQICQSI 323 +FY HT+ +F+ I +I Sbjct: 367 NFYLIHTDTYFLRDIIFAI 385 >AJ845188-1|CAH60165.1| 517|Tribolium castaneum putative esterase protein. Length = 517 Score = 20.2 bits (40), Expect = 7.4 Identities = 7/19 (36%), Positives = 12/19 (63%) Frame = -2 Query: 379 HFYNFHTNAHFMNQICQSI 323 +FY HT+ +F+ I +I Sbjct: 369 NFYLIHTDTYFLRDIIFAI 387 >AJ845187-1|CAH60164.1| 515|Tribolium castaneum esterase protein. Length = 515 Score = 20.2 bits (40), Expect = 7.4 Identities = 7/19 (36%), Positives = 12/19 (63%) Frame = -2 Query: 379 HFYNFHTNAHFMNQICQSI 323 +FY HT+ +F+ I +I Sbjct: 367 NFYLIHTDTYFLRDIIFAI 385 >AJ844897-1|CAH59956.1| 517|Tribolium castaneum esterase protein. Length = 517 Score = 20.2 bits (40), Expect = 7.4 Identities = 7/19 (36%), Positives = 12/19 (63%) Frame = -2 Query: 379 HFYNFHTNAHFMNQICQSI 323 +FY HT+ +F+ I +I Sbjct: 369 NFYLIHTDTYFLRDIIFAI 387 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 80,830 Number of Sequences: 336 Number of extensions: 1355 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 51 effective length of database: 105,449 effective search space used: 8014124 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -