BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0255 (569 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_UPI0001597C7B Cluster: hypothetical protein RBAM_037100... 35 1.5 UniRef50_Q23JE5 Cluster: Hypothetical repeat containing protein;... 32 8.2 >UniRef50_UPI0001597C7B Cluster: hypothetical protein RBAM_037100; n=1; Bacillus amyloliquefaciens FZB42|Rep: hypothetical protein RBAM_037100 - Bacillus amyloliquefaciens FZB42 Length = 79 Score = 34.7 bits (76), Expect = 1.5 Identities = 16/47 (34%), Positives = 25/47 (53%) Frame = +3 Query: 210 HYSNE*YLTMILH*YQSNTIKSAEAGFLTLGSHCVYGYPLWLSSCHE 350 H++ Y + + Y+SN + + F+ LG CVYG WL SC + Sbjct: 35 HFTQVFYKKLYIRVYKSN--ERSYPHFMNLGRWCVYGKSFWLCSCFD 79 >UniRef50_Q23JE5 Cluster: Hypothetical repeat containing protein; n=1; Tetrahymena thermophila SB210|Rep: Hypothetical repeat containing protein - Tetrahymena thermophila SB210 Length = 3955 Score = 32.3 bits (70), Expect = 8.2 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = -3 Query: 264 CYFDTNAISWLNIIHCCSVQVSLALPLNFVFENE 163 C+ DTN+I + I HCC + A L ++ EN+ Sbjct: 1447 CFNDTNSICFDQINHCCVNYTNSAFYLGYIIENK 1480 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 430,403,316 Number of Sequences: 1657284 Number of extensions: 6838363 Number of successful extensions: 9463 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 9303 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9462 length of database: 575,637,011 effective HSP length: 96 effective length of database: 416,537,747 effective search space used: 38738010471 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -