Bombyx BLAST Result against tribolium

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NRPG0255
         (569 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ372925-1|ABD17350.1|  596|Tribolium castaneum telomerase rever...    24   1.0  
AY884064-1|AAX84205.1|  683|Tribolium castaneum pro-phenol oxida...    21   5.6  
AY884063-1|AAX84204.1|  682|Tribolium castaneum pro-phenol oxida...    21   5.6  

>DQ372925-1|ABD17350.1|  596|Tribolium castaneum telomerase reverse
           transcriptase protein.
          Length = 596

 Score = 23.8 bits (49), Expect = 1.0
 Identities = 14/44 (31%), Positives = 22/44 (50%)
 Frame = +2

Query: 377 YMLHSAKLKLFSAIIVNIISFPALVLMLSINMYECDRYIKDIIT 508
           Y   +A + L ++ +VN   F  LVL  ++  Y   R  K I+T
Sbjct: 476 YKFDAAMMALRTSFLVNDFGFIWLVLSSTVRAY-ASRAFKKIVT 518


>AY884064-1|AAX84205.1|  683|Tribolium castaneum pro-phenol oxidase
           subunit 2 protein.
          Length = 683

 Score = 21.4 bits (43), Expect = 5.6
 Identities = 5/7 (71%), Positives = 7/7 (100%)
 Frame = -1

Query: 203 YHWHYHL 183
           +HWH+HL
Sbjct: 206 HHWHWHL 212


>AY884063-1|AAX84204.1|  682|Tribolium castaneum pro-phenol oxidase
           subunit 1 protein.
          Length = 682

 Score = 21.4 bits (43), Expect = 5.6
 Identities = 5/7 (71%), Positives = 7/7 (100%)
 Frame = -1

Query: 203 YHWHYHL 183
           +HWH+HL
Sbjct: 206 HHWHWHL 212


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 111,306
Number of Sequences: 336
Number of extensions: 2122
Number of successful extensions: 3
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3
length of database: 122,585
effective HSP length: 54
effective length of database: 104,441
effective search space used: 14099535
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)