BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0255 (569 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g20370.1 68416.m02581 meprin and TRAF homology domain-contain... 27 6.7 At2g43790.1 68415.m05443 mitogen-activated protein kinase, putat... 27 6.7 >At3g20370.1 68416.m02581 meprin and TRAF homology domain-containing protein / MATH domain-containing protein similar to ubiquitin-specific protease 12 [Arabidopsis thaliana] GI:11993471; contains Pfam profile PF00917: MATH domain Length = 379 Score = 27.5 bits (58), Expect = 6.7 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = +3 Query: 261 NTIKSAEAGFLTLGSHCVYGYPLWLSSCHEK 353 +T K G+L G HC +G + + S +EK Sbjct: 196 DTFKDPTKGYLYDGDHCEFGVDVTMPSLYEK 226 >At2g43790.1 68415.m05443 mitogen-activated protein kinase, putative / MAPK, putative (MPK6) identical to mitogen-activated protein kinase homolog 6 (AtMPK6)[Arabidopsis thaliana] SWISS-PROT:Q39026; PMID:12119167 Length = 395 Score = 27.5 bits (58), Expect = 6.7 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = -3 Query: 255 DTNAISWLNIIHCCSVQVSLALPLNFVFENECL 157 D A +LN +H S + +P NF FEN L Sbjct: 341 DALAHPYLNSLHDISDEPECTIPFNFDFENHAL 373 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,389,826 Number of Sequences: 28952 Number of extensions: 154510 Number of successful extensions: 219 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 217 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 219 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1102220672 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -