BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0247 (394 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_06_0891 - 32752825-32752932,32753085-32753176,32753293-327534... 27 7.1 06_02_0107 - 11904636-11904699,11904940-11905013,11905671-119058... 26 9.4 >01_06_0891 - 32752825-32752932,32753085-32753176,32753293-32753408, 32754055-32755969,32756037-32756171,32756549-32756870 Length = 895 Score = 26.6 bits (56), Expect = 7.1 Identities = 11/38 (28%), Positives = 20/38 (52%) Frame = -3 Query: 218 SYIKYLSFITNNISLFTYISYAKLNVIYSASASTYLPT 105 S+ ++S +TN + +F + LN +SA+ PT Sbjct: 366 SFFNWMSTLTNGVKVFDETTAVPLNQKFSAATGEEFPT 403 >06_02_0107 - 11904636-11904699,11904940-11905013,11905671-11905802, 11910309-11911018,11911110-11911852,11911936-11913753, 11914037-11914338 Length = 1280 Score = 26.2 bits (55), Expect = 9.4 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = -3 Query: 206 YLSFITNNISLFTYISYAKLNVIYSAS 126 YL I NNI+L Y+S + N+ + S Sbjct: 750 YLKAICNNIALLKYLSLRRTNITHLPS 776 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,172,449 Number of Sequences: 37544 Number of extensions: 157295 Number of successful extensions: 283 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 279 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 283 length of database: 14,793,348 effective HSP length: 74 effective length of database: 12,015,092 effective search space used: 672845152 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -