BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0246 (621 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_46306| Best HMM Match : 6PGD (HMM E-Value=0) 139 4e-55 SB_42867| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_51002| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.3 SB_33458| Best HMM Match : HEAT (HMM E-Value=7.9e-15) 28 5.3 SB_6930| Best HMM Match : FAD_binding_7 (HMM E-Value=0) 28 5.3 SB_39539| Best HMM Match : VWA (HMM E-Value=1.8e-12) 28 5.3 SB_7213| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_33752| Best HMM Match : I-set (HMM E-Value=3.7e-15) 27 9.3 SB_3401| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.3 SB_49089| Best HMM Match : 7tm_1 (HMM E-Value=9.4e-06) 27 9.3 SB_28162| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.3 >SB_46306| Best HMM Match : 6PGD (HMM E-Value=0) Length = 870 Score = 139 bits (337), Expect(2) = 4e-55 Identities = 59/84 (70%), Positives = 68/84 (80%) Frame = +3 Query: 369 IPLLSKGDIIIDGGNSQYLDTQKWCKELSGTGILYVGMGVSGGEDGARYGPSLMPGGHPA 548 +PLL GDIIIDGGNS+Y D+ + CK L G+L+VG GVSGGE+GARYGPSLMPGG Sbjct: 135 VPLLESGDIIIDGGNSEYKDSMRRCKALEERGLLFVGSGVSGGEEGARYGPSLMPGGSEK 194 Query: 549 AWPHIKEIFQAICAKANDEPCCDW 620 AWPHIK IFQAI AKA ++PCCDW Sbjct: 195 AWPHIKPIFQAIAAKAGNDPCCDW 218 Score = 93.5 bits (222), Expect(2) = 4e-55 Identities = 50/86 (58%), Positives = 62/86 (72%) Frame = +3 Query: 114 ADIALIGLAVMGQNLILNMNDKGYVVCAFNRTVSKVEEFLKNEAKGTKVIGATSLDDMVS 293 ADIALIGLAVM VCA NRTV KV+ FL NEAKGT+++GA SL +MVS Sbjct: 31 ADIALIGLAVM--------------VCAHNRTVEKVDRFLANEAKGTRIVGAHSLQEMVS 76 Query: 294 KLKRPRKIVLLVKAGFAVDEFVKKLI 371 KLK+PR++++LVKAG AVD F+ L+ Sbjct: 77 KLKKPRRVMILVKAGSAVDAFIDHLV 102 >SB_42867| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 870 Score = 33.9 bits (74), Expect = 0.11 Identities = 14/32 (43%), Positives = 16/32 (50%), Gaps = 1/32 (3%) Frame = +2 Query: 470 LCWNGCKWR*RWCTI-WTIFDAWWASCCMAAY 562 LC GC W I WTI D W+ CCM + Sbjct: 627 LCLTGCAVLESWAGIHWTIPDGTWSGCCMVPF 658 >SB_51002| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1888 Score = 28.3 bits (60), Expect = 5.3 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = +3 Query: 444 KELSGTGILYVGMGVSGGEDGARYGPSLMPGG 539 + L G G YVG+ +S +G+R GP + P G Sbjct: 711 ENLEGRGGDYVGISLSTSTEGSRGGPHVDPKG 742 >SB_33458| Best HMM Match : HEAT (HMM E-Value=7.9e-15) Length = 875 Score = 28.3 bits (60), Expect = 5.3 Identities = 30/128 (23%), Positives = 53/128 (41%), Gaps = 1/128 (0%) Frame = +3 Query: 45 NNSMFKIVR*TFKI*LKKMPQN-EADIALIGLAVMGQNLILNMNDKGYVVCAFNRTVSKV 221 N+ + ++V TF + P + D+ L M + L+++++D + K Sbjct: 368 NDEIRRVVTSTFLAYFRAFPDGYDCDLYKFHLQAMFKGLLIHLDDPTPTIQEAVLAALKQ 427 Query: 222 EEFLKNEAKGTKVIGATSLDDMVSKLKRPRKIVLLVKAGFAVDEFVKKLIPLLSKGDIII 401 +K +V A V+++K P+K K A+ V L P L DII+ Sbjct: 428 AAHVKPSILKEQV-EAVKHKHRVARMKSPKKEQHTTKFVAALISKVSVLDPALDFSDIIL 486 Query: 402 DGGNSQYL 425 G S+ L Sbjct: 487 TGSVSEGL 494 >SB_6930| Best HMM Match : FAD_binding_7 (HMM E-Value=0) Length = 506 Score = 28.3 bits (60), Expect = 5.3 Identities = 15/48 (31%), Positives = 22/48 (45%) Frame = -2 Query: 599 ISFSAYGLENFFYMRPCSRMPTRHQRWSISCTIFTSTYTHSNIKYSCP 456 +S + Y L++FF PC +P ++ C T T H I Y P Sbjct: 166 VSHTLYDLDSFFTRSPCCTLPAIDKKMVAGCNTPT-TANHDKI-YGVP 211 >SB_39539| Best HMM Match : VWA (HMM E-Value=1.8e-12) Length = 515 Score = 28.3 bits (60), Expect = 5.3 Identities = 21/68 (30%), Positives = 31/68 (45%) Frame = -3 Query: 421 YCELPPSIIISPLLKSGISFFTNSSTANPAFTKRTIFLGLFSLDTMSSKEVAPITFVPLA 242 Y +PP KS I STAN +K TI + ++DT S++E++ L Sbjct: 115 YPTMPPDEEPKDKHKSDIHKALEHSTANKQ-SKMTILIDYVNIDTRSTREISTKRLHQLN 173 Query: 241 SFFRNSST 218 RN+ T Sbjct: 174 QQVRNTFT 181 >SB_7213| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 256 Score = 27.9 bits (59), Expect = 7.0 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = +3 Query: 462 GILYVGMGVSGGEDGARYGPSLMPGGHPAAWPHI 563 G++ V M SG G+ Y P + P G+P H+ Sbjct: 25 GVIEVKMSASGFVSGSFYTPDVSPYGYPIHTNHL 58 >SB_33752| Best HMM Match : I-set (HMM E-Value=3.7e-15) Length = 783 Score = 27.5 bits (58), Expect = 9.3 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = +3 Query: 147 GQNLILNMNDKGYVVCAFNRTVSKVEEFLKNE 242 G+ + MND G CA N TV++ EE ++E Sbjct: 398 GEYCCVAMNDAGRTTCAGNLTVAEEEEESESE 429 >SB_3401| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 475 Score = 27.5 bits (58), Expect = 9.3 Identities = 12/33 (36%), Positives = 22/33 (66%) Frame = -1 Query: 426 LSIVNYHHQL*YHLCLKVVLAFSQTRQQQIQLL 328 LS +N H + LCL+++ F +T+Q Q+++L Sbjct: 184 LSTLNGHQKALNILCLRLLWNFIETKQDQLRVL 216 >SB_49089| Best HMM Match : 7tm_1 (HMM E-Value=9.4e-06) Length = 250 Score = 27.5 bits (58), Expect = 9.3 Identities = 17/44 (38%), Positives = 24/44 (54%), Gaps = 2/44 (4%) Frame = -2 Query: 521 WSISCTIFTSTYTHSNIKYSCP*QLFTPF--LCV*VL*ITTINY 396 WS +CTI ++Y I +S P + P LC+ VL I I+Y Sbjct: 76 WSAACTISLASYFSLAIFHSQPMSTYIPMTSLCIAVL-IMVISY 118 >SB_28162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 561 Score = 27.5 bits (58), Expect = 9.3 Identities = 20/54 (37%), Positives = 28/54 (51%), Gaps = 3/54 (5%) Frame = +3 Query: 219 VEEFLKNEAKGTKVIGATSLDDMVSKLKRP---RKIVLLVKAGFAVDEFVKKLI 371 VE +K + K V A + D+ +L RP +V V GFAVD+FVK + Sbjct: 31 VEIAVKEQKKKPSVDAALPVVDLQKEL-RPISLTPVVSKVAEGFAVDDFVKPAV 83 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,965,309 Number of Sequences: 59808 Number of extensions: 365489 Number of successful extensions: 866 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 806 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 865 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1536271375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -