BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0242 (657 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY943928-1|AAX49501.1| 753|Anopheles gambiae laccase-2 isoform ... 23 6.4 AJ302655-1|CAC35520.1| 332|Anopheles gambiae gSG5 protein protein. 23 8.5 >AY943928-1|AAX49501.1| 753|Anopheles gambiae laccase-2 isoform A protein. Length = 753 Score = 23.4 bits (48), Expect = 6.4 Identities = 12/55 (21%), Positives = 25/55 (45%), Gaps = 2/55 (3%) Frame = -3 Query: 373 CCHKIKVPINKEI*STNIQFTGNKSINTHYHCNVKDYNYKSYTYKQNTNI--INL 215 C HK+ +P+N + + +++ +H + YN ++N+ INL Sbjct: 610 CTHKVDIPLNAIVEVVLVDEVQQPNLSHPFHLHGYAYNVVGIGRSPDSNVKKINL 664 >AJ302655-1|CAC35520.1| 332|Anopheles gambiae gSG5 protein protein. Length = 332 Score = 23.0 bits (47), Expect = 8.5 Identities = 10/34 (29%), Positives = 16/34 (47%) Frame = +3 Query: 24 LHENLHKYLVTAAVRYTNVCIFEIDVCPNINRRQ 125 L+E + Y V Y +VC+ + D C + Q Sbjct: 164 LNEQIRTYFQNEFVEYRDVCLPDEDHCMKLLHAQ 197 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 590,005 Number of Sequences: 2352 Number of extensions: 12353 Number of successful extensions: 27 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 27 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 27 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 65232180 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -