BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0236 (756 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_04_0658 - 24793219-24794109 28 7.0 07_01_0652 + 4895366-4895483,4895661-4896262 28 9.2 >02_04_0658 - 24793219-24794109 Length = 296 Score = 28.3 bits (60), Expect = 7.0 Identities = 18/64 (28%), Positives = 29/64 (45%) Frame = +3 Query: 249 IKGTLLYLHKRVKFPSFVTVILLSKAFVYFIEYEFLNAI*AFLSYIKIISPYWALLENLI 428 IK L LH F +++++ Y + + F + A L +I I+ PYW + Sbjct: 222 IKKFSLRLHLLFSF----ALMIMTLGVTYQLHHMFFILLLALLVFISIVCPYWLIRIQEY 277 Query: 429 VFEI 440 FEI Sbjct: 278 KFEI 281 >07_01_0652 + 4895366-4895483,4895661-4896262 Length = 239 Score = 27.9 bits (59), Expect = 9.2 Identities = 14/37 (37%), Positives = 22/37 (59%) Frame = +1 Query: 586 YMNVKYEPNNCGEAFSR*MIRIVKKRDSLLHFDSAFE 696 YM Y +C + R + ++V+KRDS +H SAF+ Sbjct: 134 YMECAYYRKDCRK-LRRFISKVVEKRDSAMHACSAFK 169 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,473,204 Number of Sequences: 37544 Number of extensions: 271018 Number of successful extensions: 446 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 434 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 446 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 2016060588 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -