BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0236 (756 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g26650.1 68414.m03245 expressed protein 29 4.4 At5g55960.1 68418.m06979 expressed protein 28 5.8 At3g12230.1 68416.m01526 serine carboxypeptidase S10 family prot... 28 7.7 >At1g26650.1 68414.m03245 expressed protein Length = 335 Score = 28.7 bits (61), Expect = 4.4 Identities = 14/41 (34%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = +3 Query: 288 FPSFVTVILLSK-AFVYFIEYEFLNAI*AFLSYIKIISPYW 407 FP F+TV LLSK A VY ++ + + ++ I+ W Sbjct: 111 FPVFITVSLLSKAAVVYSVDCSYSREVVDISKFLVILQKIW 151 >At5g55960.1 68418.m06979 expressed protein Length = 648 Score = 28.3 bits (60), Expect = 5.8 Identities = 17/55 (30%), Positives = 28/55 (50%) Frame = +3 Query: 243 LVIKGTLLYLHKRVKFPSFVTVILLSKAFVYFIEYEFLNAI*AFLSYIKIISPYW 407 L I G LL + F +T +L +Y I + +++ + AF+S + I PYW Sbjct: 501 LAISGVLLATAEIAFFQGCLTWLLFR---LYNIHFLYMSTVLAFISALLPIFPYW 552 >At3g12230.1 68416.m01526 serine carboxypeptidase S10 family protein contains Pfam profile: PF00450 serine carboxypeptidase; similar to serine carboxypeptidase I precursor (SP:P37890) [Oryza sativa] Length = 435 Score = 27.9 bits (59), Expect = 7.7 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = -3 Query: 532 FTKLFENKFK*GYQKNKSHVYEYKTKQNSI 443 +TK + NK K H EYK ++NSI Sbjct: 395 YTKTYANKMTLATVKGGGHTLEYKPEENSI 424 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,993,572 Number of Sequences: 28952 Number of extensions: 266005 Number of successful extensions: 503 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 495 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 503 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1682736544 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -