BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0233 (344 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC13G6.07c |rps601|rps6-1|40S ribosomal protein S6|Schizosacch... 149 1e-37 SPAPB1E7.12 |rps602|rps6-2, rps6|40S ribosomal protein S6|Schizo... 149 1e-37 SPAC31A2.14 |||WD repeat protein, human WRDR48 family|Schizosacc... 25 3.3 SPBC1709.08 |cft1||cleavage factor one Cft1 |Schizosaccharomyces... 25 4.4 SPCC1450.14c |ero12||ER oxidoreductin Ero1b|Schizosaccharomyces ... 24 5.8 >SPAC13G6.07c |rps601|rps6-1|40S ribosomal protein S6|Schizosaccharomyces pombe|chr 1|||Manual Length = 239 Score = 149 bits (361), Expect = 1e-37 Identities = 67/98 (68%), Positives = 77/98 (78%) Frame = +2 Query: 50 MKLNVSYPATGCQKLFEVVDEHKLRIFYEKRMGAEVEADQLGDEWKGYVLRVAGGNDKQG 229 MKLN+SYPA G QKL E+ D+ +LR+F EKRMG EV D +G E+ GYV ++ GGNDKQG Sbjct: 1 MKLNISYPANGTQKLIEIDDDRRLRVFMEKRMGQEVPGDSVGPEFAGYVFKITGGNDKQG 60 Query: 230 FPMKQGVLTNSRVRLLMSKGHSCYRPRRDGERKRKSVR 343 FPM QGVL RVRLL+ GH CYRPRRDGERKRKSVR Sbjct: 61 FPMFQGVLLPHRVRLLLRAGHPCYRPRRDGERKRKSVR 98 >SPAPB1E7.12 |rps602|rps6-2, rps6|40S ribosomal protein S6|Schizosaccharomyces pombe|chr 1|||Manual Length = 239 Score = 149 bits (361), Expect = 1e-37 Identities = 67/98 (68%), Positives = 77/98 (78%) Frame = +2 Query: 50 MKLNVSYPATGCQKLFEVVDEHKLRIFYEKRMGAEVEADQLGDEWKGYVLRVAGGNDKQG 229 MKLN+SYPA G QKL E+ D+ +LR+F EKRMG EV D +G E+ GYV ++ GGNDKQG Sbjct: 1 MKLNISYPANGTQKLIEIDDDRRLRVFMEKRMGQEVPGDSVGPEFAGYVFKITGGNDKQG 60 Query: 230 FPMKQGVLTNSRVRLLMSKGHSCYRPRRDGERKRKSVR 343 FPM QGVL RVRLL+ GH CYRPRRDGERKRKSVR Sbjct: 61 FPMFQGVLLPHRVRLLLRAGHPCYRPRRDGERKRKSVR 98 >SPAC31A2.14 |||WD repeat protein, human WRDR48 family|Schizosaccharomyces pombe|chr 1|||Manual Length = 962 Score = 25.0 bits (52), Expect = 3.3 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +1 Query: 70 PGNGMPEVVRSGGRAQASYLLR 135 PG+G+P +V R AS +LR Sbjct: 867 PGSGLPLIVNENTRLSASAMLR 888 >SPBC1709.08 |cft1||cleavage factor one Cft1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 1441 Score = 24.6 bits (51), Expect = 4.4 Identities = 14/53 (26%), Positives = 23/53 (43%) Frame = -1 Query: 245 PVSSGILACRCRQRHEVHSPSIHRLTDQPLLRRPCAFRKRYEACARPPLRTTS 87 P+SS I H H+P + D+ R C F++ +E + P + S Sbjct: 970 PISSNIPILSVAPFHAHHAPQGYIYVDENSFIRICKFQEDFEYDNKWPYKKVS 1022 >SPCC1450.14c |ero12||ER oxidoreductin Ero1b|Schizosaccharomyces pombe|chr 3|||Manual Length = 571 Score = 24.2 bits (50), Expect = 5.8 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = +1 Query: 46 SHEVKRFVPGNGMPEV 93 SH ++R++P N PEV Sbjct: 553 SHHLQRYIPKNWFPEV 568 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,411,135 Number of Sequences: 5004 Number of extensions: 26460 Number of successful extensions: 69 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 68 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 69 length of database: 2,362,478 effective HSP length: 64 effective length of database: 2,042,222 effective search space used: 102111100 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -