BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0222 (580 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. 23 1.9 AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. 23 1.9 DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 22 4.3 DQ855501-1|ABH88188.1| 146|Tribolium castaneum chemosensory pro... 21 5.7 AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface pro... 21 5.7 >AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. Length = 712 Score = 23.0 bits (47), Expect = 1.9 Identities = 13/43 (30%), Positives = 21/43 (48%), Gaps = 2/43 (4%) Frame = -2 Query: 486 LTVGRDARLSI*NEAGSIKYLNIAVFTKSPVKLLTIT--RIYR 364 + G+D + N G + N T +P+++ TIT R YR Sbjct: 303 VNTGQDPESLLINGKGQFRDPNTGFMTNTPLEVFTITPGRRYR 345 >AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. Length = 717 Score = 23.0 bits (47), Expect = 1.9 Identities = 13/43 (30%), Positives = 21/43 (48%), Gaps = 2/43 (4%) Frame = -2 Query: 486 LTVGRDARLSI*NEAGSIKYLNIAVFTKSPVKLLTIT--RIYR 364 + G+D + N G + N T +P+++ TIT R YR Sbjct: 303 VNTGQDPESLLINGKGQFRDPNTGFMTNTPLEVFTITPGRRYR 345 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 21.8 bits (44), Expect = 4.3 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = -2 Query: 306 QLHWKLPFDTGFKITR 259 QL W PFD ITR Sbjct: 913 QLSWVAPFDGNSPITR 928 >DQ855501-1|ABH88188.1| 146|Tribolium castaneum chemosensory protein 15 protein. Length = 146 Score = 21.4 bits (43), Expect = 5.7 Identities = 9/28 (32%), Positives = 15/28 (53%) Frame = -1 Query: 439 VHKIFEHSSFHEVSREIINYYQDLSLKY 356 VHK+F+H H N++ +L K+ Sbjct: 81 VHKVFQHLMIHRP-----NWWHELETKF 103 >AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface protein chaoptin protein. Length = 782 Score = 21.4 bits (43), Expect = 5.7 Identities = 10/44 (22%), Positives = 23/44 (52%) Frame = -1 Query: 217 NKKIDDAYFVKGSVLSASFLTFSIALELTKIFIELERLPTFAAR 86 ++ + + YF SV + TF+ ++L +I ++ R+ + R Sbjct: 91 HRDLTEVYFSFNSVRNVQQHTFADLIQLEQIHLDDNRIESLERR 134 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 125,958 Number of Sequences: 336 Number of extensions: 2389 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 14412858 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -