BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0222 (580 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_06_0140 + 21090686-21091645,21092142-21092221,21092705-210929... 29 3.5 08_01_0963 - 9661699-9661760,9662095-9662818,9662860-9663265,966... 28 6.2 01_07_0187 + 41862342-41862622,41862730-41862912,41863236-418632... 28 6.2 >09_06_0140 + 21090686-21091645,21092142-21092221,21092705-21092906, 21093052-21093327,21093414-21093482,21093638-21093785, 21094080-21094228,21094897-21095061,21095623-21095732, 21095868-21095946,21095947-21096240 Length = 843 Score = 28.7 bits (61), Expect = 3.5 Identities = 16/35 (45%), Positives = 19/35 (54%) Frame = +1 Query: 409 ENCYVQIFYGPSFISNT*AGVPSDCKEAGGGRAHC 513 EN +VQ+F S S + G PSDCKEA C Sbjct: 501 ENWHVQVFR--SIDSGSLKGFPSDCKEASKQNLIC 533 >08_01_0963 - 9661699-9661760,9662095-9662818,9662860-9663265, 9663488-9665037 Length = 913 Score = 27.9 bits (59), Expect = 6.2 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = +1 Query: 208 FFCFFPNLSERH*VAIPSRYFKTGVKWKFPM 300 FFC PN+ RH +A+ R F ++ F M Sbjct: 71 FFCCLPNIHRRHEIAVRIRNFNFELEKIFKM 101 >01_07_0187 + 41862342-41862622,41862730-41862912,41863236-41863299, 41863547-41863756,41863850-41864035,41864180-41864478, 41864584-41864731,41864798-41864863,41864945-41865217, 41865523-41865741,41865864-41866013 Length = 692 Score = 27.9 bits (59), Expect = 6.2 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = +3 Query: 105 KRSNSMKILVNSNAIEKVKKLALSTLPLT 191 KRSNSM++ SN +LA+ LP T Sbjct: 123 KRSNSMELFTVSNVARGSNRLAILQLPFT 151 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,134,395 Number of Sequences: 37544 Number of extensions: 258863 Number of successful extensions: 563 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 547 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 563 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1352600424 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -