BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0222 (580 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY071420-1|AAL49042.1| 302|Drosophila melanogaster RE50009p pro... 31 1.1 AE014297-279|AAF52006.1| 302|Drosophila melanogaster CG2931-PA ... 31 1.1 >AY071420-1|AAL49042.1| 302|Drosophila melanogaster RE50009p protein. Length = 302 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/30 (43%), Positives = 20/30 (66%) Frame = +3 Query: 453 KYLGGRPVRL*GSRWGSRSLCLVRVFERSR 542 +Y+G RP++L S W RSL +V+ ER + Sbjct: 262 RYVGSRPIKLRKSTWRQRSLDVVKKKEREK 291 >AE014297-279|AAF52006.1| 302|Drosophila melanogaster CG2931-PA protein. Length = 302 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/30 (43%), Positives = 20/30 (66%) Frame = +3 Query: 453 KYLGGRPVRL*GSRWGSRSLCLVRVFERSR 542 +Y+G RP++L S W RSL +V+ ER + Sbjct: 262 RYVGSRPIKLRKSTWRQRSLDVVKKKEREK 291 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,763,947 Number of Sequences: 53049 Number of extensions: 446442 Number of successful extensions: 1058 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 941 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1051 length of database: 24,988,368 effective HSP length: 81 effective length of database: 20,691,399 effective search space used: 2296745289 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -