BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0219 (459 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC6G10.12c |ace2||transcription factor Ace2|Schizosaccharomyce... 27 1.8 SPCC18B5.01c |bfr1|hba2, SPCPJ732.04c|brefeldin A efflux transpo... 26 3.2 SPBC839.12 |rpc31||DNA-directed RNA polymerase III complex subun... 25 7.3 >SPAC6G10.12c |ace2||transcription factor Ace2|Schizosaccharomyces pombe|chr 1|||Manual Length = 533 Score = 26.6 bits (56), Expect = 1.8 Identities = 19/53 (35%), Positives = 23/53 (43%) Frame = -2 Query: 179 HAVFVSSCKKR*EQSIR*RFITSSTQPLRSFQKQIDYSS*RELPVPLSLVPNS 21 H F S E S+ I S L++FQ Q DYSS + P L NS Sbjct: 41 HTSFSSFAPFENEVSLNQAVIPSPPSHLQNFQDQFDYSSVLKTPFNPLLEANS 93 >SPCC18B5.01c |bfr1|hba2, SPCPJ732.04c|brefeldin A efflux transporter Bfr1|Schizosaccharomyces pombe|chr 3|||Manual Length = 1530 Score = 25.8 bits (54), Expect = 3.2 Identities = 14/38 (36%), Positives = 22/38 (57%) Frame = -3 Query: 292 LPPLNVPLDLFEYVIFLHLLFLKRIAGSFESYNLFVIV 179 LP + + +F V++ L LKR AG F +Y LF+ + Sbjct: 624 LPFRFINISVFSIVLYF-LTNLKRTAGGFWTYFLFLFI 660 >SPBC839.12 |rpc31||DNA-directed RNA polymerase III complex subunit Rpc31|Schizosaccharomyces pombe|chr 2|||Manual Length = 210 Score = 24.6 bits (51), Expect = 7.3 Identities = 13/50 (26%), Positives = 25/50 (50%) Frame = -1 Query: 450 VESCSRASHSQVSPSRDVPKQKPIISGEIITPRXRHNXNIIHLKASAFAV 301 +E + ++ +++ P RD+P Q+ I E++ R L SAF + Sbjct: 20 LEFNANSTPTKLYPDRDIPLQRSIRPEELLELRFYKEIRTSFLDESAFYI 69 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,832,719 Number of Sequences: 5004 Number of extensions: 33580 Number of successful extensions: 68 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 66 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 68 length of database: 2,362,478 effective HSP length: 67 effective length of database: 2,027,210 effective search space used: 172312850 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -