BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0219 (459 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_967| Best HMM Match : Calx-beta (HMM E-Value=2.8) 31 0.61 SB_7024| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.80 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_31108| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_21994| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_17082| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_54935| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.8 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.8 SB_55260| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.8 SB_6998| Best HMM Match : Ribonuclease_T2 (HMM E-Value=8) 29 1.8 SB_18249| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.4 SB_42248| Best HMM Match : Keratin_B2 (HMM E-Value=4.4) 29 2.4 SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.2 SB_7650| Best HMM Match : SLR1-BP (HMM E-Value=0.71) 28 3.2 SB_50032| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.2 SB_42082| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.3 SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.3 SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) 28 4.3 SB_54105| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.3 SB_40500| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.3 SB_39514| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.3 SB_38326| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.3 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 27 5.6 SB_36172| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.6 SB_21764| Best HMM Match : TPP_enzyme_N (HMM E-Value=1.1e-06) 27 5.6 SB_9512| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.6 SB_58927| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.6 SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.6 SB_46352| Best HMM Match : L71 (HMM E-Value=0.19) 27 5.6 SB_45805| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.6 SB_17697| Best HMM Match : JmjC (HMM E-Value=2.4e-11) 27 5.6 SB_14766| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.6 SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.6 SB_4159| Best HMM Match : Vpu (HMM E-Value=2) 27 5.6 SB_40646| Best HMM Match : eIF-5a (HMM E-Value=0.87) 27 7.5 SB_55485| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.5 SB_50444| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.5 SB_36256| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.5 SB_24023| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.5 SB_19315| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.5 SB_6786| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.5 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) 27 9.9 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 27 9.9 SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_42990| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_35514| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_33387| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_25468| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_59378| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_59324| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_56967| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_56871| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_55181| Best HMM Match : DVL (HMM E-Value=6.1) 27 9.9 SB_52392| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_51524| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_49230| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_48356| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_46997| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_46049| Best HMM Match : SH2 (HMM E-Value=6.4) 27 9.9 SB_45427| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_43731| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_41197| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_35822| Best HMM Match : DUF765 (HMM E-Value=3.3) 27 9.9 SB_30190| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_27240| Best HMM Match : DUF765 (HMM E-Value=9.1) 27 9.9 SB_24786| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_19004| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_17901| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_15081| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_14826| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_14383| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_13469| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_12831| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_12453| Best HMM Match : DUF765 (HMM E-Value=5) 27 9.9 SB_9975| Best HMM Match : 7tm_2 (HMM E-Value=1.9e-38) 27 9.9 SB_9638| Best HMM Match : WD40 (HMM E-Value=8.4e-09) 27 9.9 >SB_967| Best HMM Match : Calx-beta (HMM E-Value=2.8) Length = 123 Score = 30.7 bits (66), Expect = 0.61 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +2 Query: 2 VDPPGCRNSARGSKEPAIL 58 VDPPGCRNS PA+L Sbjct: 16 VDPPGCRNSIEDFNVPAVL 34 >SB_7024| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 30.3 bits (65), Expect = 0.80 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = -2 Query: 83 KQIDYSS*RELPVPLSLVPNSCSPGDP 3 K +S+ + PL L NSCSPGDP Sbjct: 18 KNTTFSTLKTKNAPLKLSSNSCSPGDP 44 >SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 29.9 bits (64), Expect = 1.1 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = -2 Query: 47 VPLSLVPNSCSPGDP 3 V +SL+ NSCSPGDP Sbjct: 29 VSISLISNSCSPGDP 43 >SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 29.9 bits (64), Expect = 1.1 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = -2 Query: 47 VPLSLVPNSCSPGDP 3 V +SL+ NSCSPGDP Sbjct: 29 VSISLISNSCSPGDP 43 >SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 29.9 bits (64), Expect = 1.1 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = -2 Query: 47 VPLSLVPNSCSPGDP 3 V +SL+ NSCSPGDP Sbjct: 29 VSISLISNSCSPGDP 43 >SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 29.9 bits (64), Expect = 1.1 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = -2 Query: 47 VPLSLVPNSCSPGDP 3 V +SL+ NSCSPGDP Sbjct: 29 VSISLISNSCSPGDP 43 >SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 29.9 bits (64), Expect = 1.1 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = -2 Query: 47 VPLSLVPNSCSPGDP 3 V +SL+ NSCSPGDP Sbjct: 29 VSISLISNSCSPGDP 43 >SB_31108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 29.9 bits (64), Expect = 1.1 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = -2 Query: 47 VPLSLVPNSCSPGDP 3 V +SL+ NSCSPGDP Sbjct: 29 VSISLISNSCSPGDP 43 >SB_21994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 29.9 bits (64), Expect = 1.1 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = -2 Query: 47 VPLSLVPNSCSPGDP 3 V +SL+ NSCSPGDP Sbjct: 30 VSISLISNSCSPGDP 44 >SB_17082| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 29.9 bits (64), Expect = 1.1 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = -2 Query: 44 PLSLVPNSCSPGDP 3 PL L+ NSCSPGDP Sbjct: 18 PLFLISNSCSPGDP 31 >SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 29.9 bits (64), Expect = 1.1 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = -2 Query: 47 VPLSLVPNSCSPGDP 3 V +SL+ NSCSPGDP Sbjct: 29 VSISLISNSCSPGDP 43 >SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 29.9 bits (64), Expect = 1.1 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = -2 Query: 47 VPLSLVPNSCSPGDP 3 V +SL+ NSCSPGDP Sbjct: 27 VSISLISNSCSPGDP 41 >SB_54935| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 201 Score = 29.1 bits (62), Expect = 1.8 Identities = 14/23 (60%), Positives = 17/23 (73%), Gaps = 2/23 (8%) Frame = +2 Query: 2 VDPPGCRNSARGS--KEPAILFR 64 VDPPGCRNS GS +E AI ++ Sbjct: 16 VDPPGCRNSMIGSGGREHAIAWK 38 >SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 29.1 bits (62), Expect = 1.8 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -2 Query: 50 PVPLSLVPNSCSPGDP 3 PV +L+ NSCSPGDP Sbjct: 57 PVSRTLLSNSCSPGDP 72 >SB_55260| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 29.1 bits (62), Expect = 1.8 Identities = 15/31 (48%), Positives = 18/31 (58%) Frame = -2 Query: 95 RSFQKQIDYSS*RELPVPLSLVPNSCSPGDP 3 R QK I Y + R P+ + NSCSPGDP Sbjct: 15 REGQKTIPYPAVRTQK-PVIFLSNSCSPGDP 44 >SB_6998| Best HMM Match : Ribonuclease_T2 (HMM E-Value=8) Length = 185 Score = 29.1 bits (62), Expect = 1.8 Identities = 15/36 (41%), Positives = 22/36 (61%) Frame = -3 Query: 154 KNAKSKALDSVSLHRALNHYGRFKNK*IIAPKENCR 47 + AKSK + V+L +A+ R+KNK + ENCR Sbjct: 16 RKAKSKDEEEVALAQAVPASTRYKNKWCVNMFENCR 51 >SB_18249| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 28.7 bits (61), Expect = 2.4 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -1 Query: 39 EPRAEFLQPGGST 1 +PR EFLQPGGST Sbjct: 39 DPRIEFLQPGGST 51 >SB_42248| Best HMM Match : Keratin_B2 (HMM E-Value=4.4) Length = 736 Score = 28.7 bits (61), Expect = 2.4 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -2 Query: 50 PVPLSLVPNSCSPGDP 3 P P+ + NSCSPGDP Sbjct: 606 PPPVHFLSNSCSPGDP 621 >SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 28.3 bits (60), Expect = 3.2 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = -2 Query: 47 VPLSLVPNSCSPGDP 3 +P +L NSCSPGDP Sbjct: 11 LPTALTSNSCSPGDP 25 >SB_7650| Best HMM Match : SLR1-BP (HMM E-Value=0.71) Length = 439 Score = 28.3 bits (60), Expect = 3.2 Identities = 15/38 (39%), Positives = 23/38 (60%) Frame = -1 Query: 114 IEHSTITVVSKTNRL*LLKRIAGSFEPRAEFLQPGGST 1 ++ ST+ +KT+ + ++E R EFLQPGGST Sbjct: 206 LDRSTLRTDNKTHY-----SVRHTYENRIEFLQPGGST 238 >SB_50032| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 28.3 bits (60), Expect = 3.2 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -2 Query: 41 LSLVPNSCSPGDP 3 +SL+ NSCSPGDP Sbjct: 31 VSLISNSCSPGDP 43 >SB_42082| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 27.9 bits (59), Expect = 4.3 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = +2 Query: 2 VDPPGCRNSARGSKEPAI 55 VDPPGCRNS + + AI Sbjct: 16 VDPPGCRNSIHKALDAAI 33 >SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 27.9 bits (59), Expect = 4.3 Identities = 10/13 (76%), Positives = 11/13 (84%) Frame = -2 Query: 41 LSLVPNSCSPGDP 3 L L+ NSCSPGDP Sbjct: 35 LDLISNSCSPGDP 47 >SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) Length = 2506 Score = 27.9 bits (59), Expect = 4.3 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +2 Query: 2 VDPPGCRNSARGSKEPAI 55 VDPPGCRNS S + I Sbjct: 660 VDPPGCRNSISSSNQRKI 677 >SB_54105| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 27.9 bits (59), Expect = 4.3 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -2 Query: 68 SS*RELPVPLSLVPNSCSPGDP 3 SS LP L V NSCSPGDP Sbjct: 52 SSPWRLPGNLRPVSNSCSPGDP 73 >SB_40500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 27.9 bits (59), Expect = 4.3 Identities = 10/12 (83%), Positives = 10/12 (83%) Frame = +2 Query: 2 VDPPGCRNSARG 37 VDPPGCRNS G Sbjct: 16 VDPPGCRNSIEG 27 >SB_39514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 27.9 bits (59), Expect = 4.3 Identities = 10/15 (66%), Positives = 13/15 (86%) Frame = -2 Query: 47 VPLSLVPNSCSPGDP 3 + L++V NSCSPGDP Sbjct: 15 IVLTVVSNSCSPGDP 29 >SB_38326| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 27.9 bits (59), Expect = 4.3 Identities = 10/13 (76%), Positives = 11/13 (84%) Frame = +2 Query: 2 VDPPGCRNSARGS 40 VDPPGCRNS R + Sbjct: 16 VDPPGCRNSIRST 28 >SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) Length = 472 Score = 27.5 bits (58), Expect = 5.6 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -2 Query: 38 SLVPNSCSPGDP 3 S+V NSCSPGDP Sbjct: 346 SIVSNSCSPGDP 357 >SB_36172| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 27.5 bits (58), Expect = 5.6 Identities = 11/17 (64%), Positives = 14/17 (82%), Gaps = 1/17 (5%) Frame = +2 Query: 2 VDPPGCRNSAR-GSKEP 49 VDPPGCRNS + +K+P Sbjct: 16 VDPPGCRNSMKPAAKKP 32 >SB_21764| Best HMM Match : TPP_enzyme_N (HMM E-Value=1.1e-06) Length = 183 Score = 27.5 bits (58), Expect = 5.6 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = +2 Query: 2 VDPPGCRNSAR 34 VDPPGCRNS R Sbjct: 16 VDPPGCRNSIR 26 >SB_9512| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 27.5 bits (58), Expect = 5.6 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = +2 Query: 2 VDPPGCRNSARGSKE 46 VDPPGCRNS + K+ Sbjct: 16 VDPPGCRNSIKVHKD 30 >SB_58927| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 27.5 bits (58), Expect = 5.6 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = -2 Query: 53 LPVPLSLVPNSCSPGDP 3 L V + L+ NSCSPGDP Sbjct: 2 LYVRIYLISNSCSPGDP 18 >SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 27.5 bits (58), Expect = 5.6 Identities = 10/13 (76%), Positives = 11/13 (84%) Frame = +2 Query: 2 VDPPGCRNSARGS 40 VDPPGCRNS G+ Sbjct: 33 VDPPGCRNSIDGN 45 >SB_46352| Best HMM Match : L71 (HMM E-Value=0.19) Length = 179 Score = 27.5 bits (58), Expect = 5.6 Identities = 12/17 (70%), Positives = 13/17 (76%), Gaps = 2/17 (11%) Frame = +2 Query: 2 VDPPGCRNSA--RGSKE 46 VDPPGCRNS +G KE Sbjct: 16 VDPPGCRNSIKDKGEKE 32 >SB_45805| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 27.5 bits (58), Expect = 5.6 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = +2 Query: 2 VDPPGCRNSARGSKE 46 VDPPGCRNS + +E Sbjct: 16 VDPPGCRNSIKYGQE 30 >SB_17697| Best HMM Match : JmjC (HMM E-Value=2.4e-11) Length = 1054 Score = 27.5 bits (58), Expect = 5.6 Identities = 11/34 (32%), Positives = 19/34 (55%) Frame = -1 Query: 447 ESCSRASHSQVSPSRDVPKQKPIISGEIITPRXR 346 E+ H+QV +DVP ++P+ E+I + R Sbjct: 53 ETIPSVGHAQVGEGQDVPNKEPMTVKELIKEKIR 86 >SB_14766| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 27.5 bits (58), Expect = 5.6 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = -2 Query: 47 VPLSLVPNSCSPGDP 3 +P V NSCSPGDP Sbjct: 5 IPTVTVSNSCSPGDP 19 >SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 27.5 bits (58), Expect = 5.6 Identities = 10/12 (83%), Positives = 10/12 (83%) Frame = +2 Query: 2 VDPPGCRNSARG 37 VDPPGCRNS G Sbjct: 92 VDPPGCRNSIAG 103 >SB_4159| Best HMM Match : Vpu (HMM E-Value=2) Length = 779 Score = 27.5 bits (58), Expect = 5.6 Identities = 10/12 (83%), Positives = 10/12 (83%) Frame = +2 Query: 2 VDPPGCRNSARG 37 VDPPGCRNS G Sbjct: 103 VDPPGCRNSITG 114 >SB_40646| Best HMM Match : eIF-5a (HMM E-Value=0.87) Length = 209 Score = 27.1 bits (57), Expect = 7.5 Identities = 9/15 (60%), Positives = 13/15 (86%) Frame = +2 Query: 2 VDPPGCRNSARGSKE 46 VDPPGCRNS + +++ Sbjct: 16 VDPPGCRNSIKRTQQ 30 >SB_55485| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 27.1 bits (57), Expect = 7.5 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -1 Query: 42 FEPRAEFLQPGGST 1 + P EFLQPGGST Sbjct: 26 YNPEIEFLQPGGST 39 >SB_50444| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 27.1 bits (57), Expect = 7.5 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = -2 Query: 47 VPLSLVPNSCSPGDP 3 + ++ V NSCSPGDP Sbjct: 14 ISIAFVSNSCSPGDP 28 >SB_36256| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 27.1 bits (57), Expect = 7.5 Identities = 13/24 (54%), Positives = 15/24 (62%) Frame = +2 Query: 2 VDPPGCRNSARGSKEPAILFRSYN 73 VDPPGCRNS S E ++ YN Sbjct: 16 VDPPGCRNSMVAS-ELMEIYSMYN 38 >SB_24023| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1268 Score = 27.1 bits (57), Expect = 7.5 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = -1 Query: 348 RHNXNIIHLKASAFAVSLRCHP*MSH*ICLN 256 RHN NI+ K SA + C P + ICL+ Sbjct: 82 RHNGNIVDDKTSATHIVHACPPPLPEAICLH 112 >SB_19315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 27.1 bits (57), Expect = 7.5 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -2 Query: 53 LPVPLSLVPNSCSPGDP 3 +P + L NSCSPGDP Sbjct: 5 IPYFIMLASNSCSPGDP 21 >SB_6786| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 27.1 bits (57), Expect = 7.5 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = -1 Query: 78 NRL*LLKRIAGSFEPRAEFLQPGGST 1 N++ + R G E EFLQPGGST Sbjct: 27 NKIGPIGRPPGIIECNIEFLQPGGST 52 >SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 26.6 bits (56), Expect = 9.9 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = -2 Query: 35 LVPNSCSPGDP 3 LV NSCSPGDP Sbjct: 24 LVSNSCSPGDP 34 >SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) Length = 295 Score = 26.6 bits (56), Expect = 9.9 Identities = 15/35 (42%), Positives = 19/35 (54%) Frame = -1 Query: 105 STITVVSKTNRL*LLKRIAGSFEPRAEFLQPGGST 1 +T + + N L K + S P EFLQPGGST Sbjct: 86 TTSAMADRINILRKGKWHSSSRGPNIEFLQPGGST 120 >SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) Length = 385 Score = 26.6 bits (56), Expect = 9.9 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = -2 Query: 59 RELPVPLSLVPNSCSPGDP 3 RE PV + NSCSPGDP Sbjct: 253 RENPVT-EYISNSCSPGDP 270 >SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 26.6 bits (56), Expect = 9.9 Identities = 14/38 (36%), Positives = 23/38 (60%) Frame = -1 Query: 114 IEHSTITVVSKTNRL*LLKRIAGSFEPRAEFLQPGGST 1 ++H T T++S ++ + + +P EFLQPGGST Sbjct: 1 MKHFTDTLISAN----IVYLLFDATKPSIEFLQPGGST 34 >SB_42990| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 26.6 bits (56), Expect = 9.9 Identities = 17/38 (44%), Positives = 23/38 (60%) Frame = -1 Query: 114 IEHSTITVVSKTNRL*LLKRIAGSFEPRAEFLQPGGST 1 ++H T T++S + L + A S P EFLQPGGST Sbjct: 1 MKHFTDTLISAN--IGLCVKSASS--PMIEFLQPGGST 34 >SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 26.6 bits (56), Expect = 9.9 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = -2 Query: 35 LVPNSCSPGDP 3 LV NSCSPGDP Sbjct: 3 LVSNSCSPGDP 13 >SB_35514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 26.6 bits (56), Expect = 9.9 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +2 Query: 2 VDPPGCRNSARGSK 43 VDPPGCRNS ++ Sbjct: 16 VDPPGCRNSMENAR 29 >SB_33387| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 888 Score = 26.6 bits (56), Expect = 9.9 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = -1 Query: 396 PKQKPIISGEIITPRXRHNXNIIHLKAS 313 PK+KP SGE+ R R + +L AS Sbjct: 95 PKEKPTASGELSVHRLRESIKSANLSAS 122 >SB_25468| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 26.6 bits (56), Expect = 9.9 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -1 Query: 45 SFEPRAEFLQPGGST 1 SF+ EFLQPGGST Sbjct: 3 SFQIHIEFLQPGGST 17 >SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 26.6 bits (56), Expect = 9.9 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = -2 Query: 35 LVPNSCSPGDP 3 LV NSCSPGDP Sbjct: 17 LVSNSCSPGDP 27 >SB_59378| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 26.6 bits (56), Expect = 9.9 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = -1 Query: 48 GSFEPRAEFLQPGGST 1 G+F EFLQPGGST Sbjct: 4 GNFTYEIEFLQPGGST 19 >SB_59324| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 26.6 bits (56), Expect = 9.9 Identities = 12/17 (70%), Positives = 13/17 (76%) Frame = -2 Query: 53 LPVPLSLVPNSCSPGDP 3 LP+P L NSCSPGDP Sbjct: 9 LPLPC-LRSNSCSPGDP 24 >SB_56967| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 26.6 bits (56), Expect = 9.9 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = -2 Query: 35 LVPNSCSPGDP 3 LV NSCSPGDP Sbjct: 9 LVSNSCSPGDP 19 >SB_56871| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 311 Score = 26.6 bits (56), Expect = 9.9 Identities = 17/38 (44%), Positives = 19/38 (50%) Frame = -2 Query: 116 TSSTQPLRSFQKQIDYSS*RELPVPLSLVPNSCSPGDP 3 T S +P R I SS R L + NSCSPGDP Sbjct: 160 TLSCRP-RHTDLVIQTSSYRPCYTDLVIQSNSCSPGDP 196 >SB_55181| Best HMM Match : DVL (HMM E-Value=6.1) Length = 175 Score = 26.6 bits (56), Expect = 9.9 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -1 Query: 36 PRAEFLQPGGST 1 P+ EFLQPGGST Sbjct: 50 PKIEFLQPGGST 61 >SB_52392| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 26.6 bits (56), Expect = 9.9 Identities = 11/16 (68%), Positives = 14/16 (87%), Gaps = 1/16 (6%) Frame = -2 Query: 47 VPLSLV-PNSCSPGDP 3 VPL+++ NSCSPGDP Sbjct: 13 VPLTILGSNSCSPGDP 28 >SB_51524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 26.6 bits (56), Expect = 9.9 Identities = 12/23 (52%), Positives = 16/23 (69%), Gaps = 1/23 (4%) Frame = -1 Query: 66 LLKRIAGSFEP-RAEFLQPGGST 1 ++KR+ +F EFLQPGGST Sbjct: 1 MIKRVPATFSSIDIEFLQPGGST 23 >SB_49230| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 26.6 bits (56), Expect = 9.9 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -1 Query: 36 PRAEFLQPGGST 1 P+ EFLQPGGST Sbjct: 6 PKIEFLQPGGST 17 >SB_48356| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 235 Score = 26.6 bits (56), Expect = 9.9 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = -2 Query: 59 RELPVPLSLVPNSCSPGDP 3 R +P S NSCSPGDP Sbjct: 102 RNIPDHYSSPSNSCSPGDP 120 >SB_46997| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 26.6 bits (56), Expect = 9.9 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = -1 Query: 39 EPRAEFLQPGGST 1 E R EFLQPGGST Sbjct: 8 ESRIEFLQPGGST 20 >SB_46049| Best HMM Match : SH2 (HMM E-Value=6.4) Length = 252 Score = 26.6 bits (56), Expect = 9.9 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = -1 Query: 60 KRIAGSFEPRAEFLQPGGST 1 KR A + EFLQPGGST Sbjct: 120 KRCARAMNNMIEFLQPGGST 139 >SB_45427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 26.6 bits (56), Expect = 9.9 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = -2 Query: 47 VPLSLVPNSCSPGDP 3 V L+ NSCSPGDP Sbjct: 20 VRFPLISNSCSPGDP 34 >SB_43731| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 26.6 bits (56), Expect = 9.9 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = -2 Query: 35 LVPNSCSPGDP 3 LV NSCSPGDP Sbjct: 5 LVSNSCSPGDP 15 >SB_41197| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 26.6 bits (56), Expect = 9.9 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = -2 Query: 35 LVPNSCSPGDP 3 LV NSCSPGDP Sbjct: 2 LVSNSCSPGDP 12 >SB_35822| Best HMM Match : DUF765 (HMM E-Value=3.3) Length = 138 Score = 26.6 bits (56), Expect = 9.9 Identities = 10/12 (83%), Positives = 10/12 (83%) Frame = -2 Query: 38 SLVPNSCSPGDP 3 S V NSCSPGDP Sbjct: 12 SFVSNSCSPGDP 23 >SB_30190| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 26.6 bits (56), Expect = 9.9 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = -2 Query: 59 RELPVPLSLVPNSCSPGDP 3 +EL V + NSCSPGDP Sbjct: 19 QELKVEVQKGSNSCSPGDP 37 >SB_27240| Best HMM Match : DUF765 (HMM E-Value=9.1) Length = 137 Score = 26.6 bits (56), Expect = 9.9 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = -2 Query: 59 RELPVPLSLVPNSCSPGDP 3 R + +S NSCSPGDP Sbjct: 4 RNIDTNVSYTSNSCSPGDP 22 >SB_24786| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 26.6 bits (56), Expect = 9.9 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = -2 Query: 35 LVPNSCSPGDP 3 LV NSCSPGDP Sbjct: 26 LVSNSCSPGDP 36 >SB_19004| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 26.6 bits (56), Expect = 9.9 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = -2 Query: 47 VPLSLVPNSCSPGDP 3 + ++V NSCSPGDP Sbjct: 9 ISANIVSNSCSPGDP 23 >SB_17901| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 26.6 bits (56), Expect = 9.9 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = -2 Query: 35 LVPNSCSPGDP 3 LV NSCSPGDP Sbjct: 26 LVSNSCSPGDP 36 >SB_15081| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 26.6 bits (56), Expect = 9.9 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = -2 Query: 44 PLSLVPNSCSPGDP 3 P S NSCSPGDP Sbjct: 11 PRSTASNSCSPGDP 24 >SB_14826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 26.6 bits (56), Expect = 9.9 Identities = 12/14 (85%), Positives = 12/14 (85%), Gaps = 1/14 (7%) Frame = -2 Query: 41 LSLVP-NSCSPGDP 3 L LVP NSCSPGDP Sbjct: 25 LPLVPSNSCSPGDP 38 >SB_14383| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 26.6 bits (56), Expect = 9.9 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -2 Query: 50 PVPLSLVPNSCSPGDP 3 P ++ V NSCSPGDP Sbjct: 17 PKRVNAVSNSCSPGDP 32 >SB_13469| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2429 Score = 26.6 bits (56), Expect = 9.9 Identities = 10/20 (50%), Positives = 15/20 (75%) Frame = +2 Query: 29 ARGSKEPAILFRSYNLFVFE 88 A+GS++P +L +SYN FE Sbjct: 497 AKGSQDPDVLGQSYNTMTFE 516 >SB_12831| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 26.6 bits (56), Expect = 9.9 Identities = 16/39 (41%), Positives = 23/39 (58%), Gaps = 1/39 (2%) Frame = -1 Query: 114 IEHSTITVVSKTNRL*L-LKRIAGSFEPRAEFLQPGGST 1 ++H T T++S R + L A + + EFLQPGGST Sbjct: 1 MKHFTDTLISANIRSRVSLDPAAKTRSAKIEFLQPGGST 39 >SB_12453| Best HMM Match : DUF765 (HMM E-Value=5) Length = 140 Score = 26.6 bits (56), Expect = 9.9 Identities = 10/12 (83%), Positives = 10/12 (83%) Frame = -2 Query: 38 SLVPNSCSPGDP 3 SL NSCSPGDP Sbjct: 14 SLTSNSCSPGDP 25 >SB_9975| Best HMM Match : 7tm_2 (HMM E-Value=1.9e-38) Length = 1101 Score = 26.6 bits (56), Expect = 9.9 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = -2 Query: 41 LSLVPNSCSPGDP 3 L L NSCSPGDP Sbjct: 659 LQLASNSCSPGDP 671 >SB_9638| Best HMM Match : WD40 (HMM E-Value=8.4e-09) Length = 781 Score = 26.6 bits (56), Expect = 9.9 Identities = 12/16 (75%), Positives = 12/16 (75%), Gaps = 1/16 (6%) Frame = -2 Query: 47 VPLSLVP-NSCSPGDP 3 VP S P NSCSPGDP Sbjct: 509 VPSSSTPSNSCSPGDP 524 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,214,628 Number of Sequences: 59808 Number of extensions: 255998 Number of successful extensions: 2040 Number of sequences better than 10.0: 85 Number of HSP's better than 10.0 without gapping: 2009 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2040 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 932979724 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -