BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0218 (395 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPMIT.01 |cox1||cytochrome c oxidase 1|Schizosaccharomyces pombe... 77 8e-16 SPAC222.14c |||GTP binding protein Sey1 |Schizosaccharomyces pom... 25 3.2 SPAC1F7.11c |||transcription factor zf-fungal binuclear cluster ... 25 5.6 SPCC330.01c |rhp16|SPCC613.13c, rad16|Rad16 homolog Rhp16|Schizo... 24 9.8 >SPMIT.01 |cox1||cytochrome c oxidase 1|Schizosaccharomyces pombe|chr mitochondrial|||Manual Length = 537 Score = 77.4 bits (182), Expect = 8e-16 Identities = 41/103 (39%), Positives = 52/103 (50%), Gaps = 2/103 (1%) Frame = +3 Query: 90 ELGNPGS--LIGDDQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 263 EL PGS L G+ Q+YN ++AH N LVPL++GAPD+A+PR+ Sbjct: 45 ELSAPGSQFLSGNGQLYNVAISAHGILMIFFFIIPALFGAFGNYLVPLMIGAPDVAYPRV 104 Query: 264 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRG 392 NN F + E G G G TVYPPLSS +H G Sbjct: 105 NNFTFWLLPPALMLLLISALTEEGPGGGWTVYPPLSSITSHSG 147 >SPAC222.14c |||GTP binding protein Sey1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 762 Score = 25.4 bits (53), Expect = 3.2 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = +2 Query: 281 TPTPLPYIINFKKNCRKWCRNRMNS 355 T T YIINFKKN + R +++S Sbjct: 512 TKTTEEYIINFKKNSWLFFRKKIDS 536 >SPAC1F7.11c |||transcription factor zf-fungal binuclear cluster type |Schizosaccharomyces pombe|chr 1|||Manual Length = 782 Score = 24.6 bits (51), Expect = 5.6 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = -3 Query: 102 DFLIQLELKVLKMFQL 55 DFLIQL+ KV FQL Sbjct: 609 DFLIQLKSKVFNRFQL 624 >SPCC330.01c |rhp16|SPCC613.13c, rad16|Rad16 homolog Rhp16|Schizosaccharomyces pombe|chr 3|||Manual Length = 963 Score = 23.8 bits (49), Expect = 9.8 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = -2 Query: 337 APFSTILLEINNIRE 293 APFST EINNI + Sbjct: 55 APFSTTYSEINNIHD 69 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,296,937 Number of Sequences: 5004 Number of extensions: 20087 Number of successful extensions: 39 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 38 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 38 length of database: 2,362,478 effective HSP length: 66 effective length of database: 2,032,214 effective search space used: 132093910 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -