BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0216 (684 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U02588-1|AAA18901.1| 110|Anopheles gambiae translation initiati... 27 0.73 AJ250916-1|CAB91840.1| 435|Anopheles gambiae serine protease pr... 25 2.2 AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-conta... 25 2.9 AY578795-1|AAT07300.1| 441|Anopheles gambiae Gbb-60A2 protein. 24 5.1 CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. 23 9.0 AJ459960-1|CAD31059.1| 696|Anopheles gambiae prophenoloxidase 7... 23 9.0 AB090815-1|BAC57905.1| 492|Anopheles gambiae gag-like protein p... 23 9.0 >U02588-1|AAA18901.1| 110|Anopheles gambiae translation initiation factor protein. Length = 110 Score = 26.6 bits (56), Expect = 0.73 Identities = 18/63 (28%), Positives = 28/63 (44%), Gaps = 1/63 (1%) Frame = +1 Query: 112 EQKVGVNRLYIFLGLVAFTGLY-LVFGFGAELICNSIGFVYPAYMSMKALESPQKDDDTK 288 +Q+ G L GL A L +V E CN +P Y + L+ Q+++ + Sbjct: 33 QQRNGRKTLTTVQGLSAEYDLKKIVRACKKEFACNGTVIEHPEYGEVLQLQGDQRENICQ 92 Query: 289 WLT 297 WLT Sbjct: 93 WLT 95 >AJ250916-1|CAB91840.1| 435|Anopheles gambiae serine protease protein. Length = 435 Score = 25.0 bits (52), Expect = 2.2 Identities = 11/37 (29%), Positives = 17/37 (45%) Frame = +2 Query: 206 YATRSASCTPRTCL*RLWSHRRRMTIQNGLHIGWCTP 316 + TR SC +WS + + I G+ +G C P Sbjct: 111 HCTRYQSCKGPELKDNVWSVLQHLCIVEGISVGICCP 147 >AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-containing phosphoprotein protein. Length = 1200 Score = 24.6 bits (51), Expect = 2.9 Identities = 17/44 (38%), Positives = 25/44 (56%) Frame = -3 Query: 445 SRSRGTRCIQSAGSNRSRRCTLTASTMETSRR*NRKSTPR*KNR 314 SRSR QSAGS +S + + S + SR +R+S R ++R Sbjct: 1128 SRSRSRSRSQSAGSRKSGSRSRSRSGSQASRG-SRRSRSRSRSR 1170 >AY578795-1|AAT07300.1| 441|Anopheles gambiae Gbb-60A2 protein. Length = 441 Score = 23.8 bits (49), Expect = 5.1 Identities = 8/15 (53%), Positives = 12/15 (80%) Frame = +1 Query: 136 LYIFLGLVAFTGLYL 180 LY+ +GLV+ TG Y+ Sbjct: 14 LYVLIGLVSSTGFYI 28 >CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. Length = 1494 Score = 23.0 bits (47), Expect = 9.0 Identities = 15/76 (19%), Positives = 25/76 (32%) Frame = -2 Query: 362 NQPTMKSEKYSTIEKQAYTTQYVSHFVSSSFCGDSRAFIDMYAGYTKPIELHINSAPKPN 183 N T+ + + + E+ Q G Y T+P + +P+P Sbjct: 1053 NYHTLTTTRTHSTERPFVAVQRAHDNAKLQTIGAREESFSSYRSETEPDNSPMGGSPRPE 1112 Query: 182 TKYKPVNATKPKKMYN 135 T PV P + N Sbjct: 1113 TPAFPVTPRTPYGLSN 1128 >AJ459960-1|CAD31059.1| 696|Anopheles gambiae prophenoloxidase 7 protein. Length = 696 Score = 23.0 bits (47), Expect = 9.0 Identities = 10/33 (30%), Positives = 18/33 (54%) Frame = -2 Query: 239 YAGYTKPIELHINSAPKPNTKYKPVNATKPKKM 141 Y+G KP L I APK N + + + + +++ Sbjct: 507 YSGTAKPATLRIFLAPKRNERGQSLTFEEQRRL 539 >AB090815-1|BAC57905.1| 492|Anopheles gambiae gag-like protein protein. Length = 492 Score = 23.0 bits (47), Expect = 9.0 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = +3 Query: 429 VPRDLLPYHSSLLPEASWSYR 491 V + +LP H+S LP+ S+ +R Sbjct: 442 VKQGILPKHASNLPDVSFVHR 462 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 774,204 Number of Sequences: 2352 Number of extensions: 17512 Number of successful extensions: 249 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 248 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 249 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 68995575 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -