BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0215 (358 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC222.12c |atp2||F1-ATPase beta subunit |Schizosaccharomyces p... 79 2e-16 SPAC1687.22c |puf3|SPAC222.02c|RNA-binding protein Puf3 |Schizos... 26 1.5 SPBC23G7.10c |||NADH-dependent flavin oxidoreductase |Schizosacc... 25 3.5 SPCC1795.09 |yps1||aspartic protease Yps1|Schizosaccharomyces po... 25 4.6 SPBC56F2.04 |utp20||U3 snoRNP protein Utp20|Schizosaccharomyces ... 24 6.1 SPAC29E6.09 ||SPAC30.13|sequence orphan|Schizosaccharomyces pomb... 24 6.1 >SPAC222.12c |atp2||F1-ATPase beta subunit |Schizosaccharomyces pombe|chr 1|||Manual Length = 525 Score = 79.0 bits (186), Expect = 2e-16 Identities = 43/58 (74%), Positives = 48/58 (82%), Gaps = 3/58 (5%) Frame = +2 Query: 194 DVQFED--NLPPILNALEVQ-NRSPRLVLEVAQHLGENTVRTIAMDGTEGLVRGQPVL 358 D QFED +LP ILNALEV+ + RLVLEVAQH+GENTVRTIAMDGTEGLVRG V+ Sbjct: 66 DCQFEDADSLPSILNALEVKLPDNKRLVLEVAQHVGENTVRTIAMDGTEGLVRGTAVI 123 >SPAC1687.22c |puf3|SPAC222.02c|RNA-binding protein Puf3 |Schizosaccharomyces pombe|chr 1|||Manual Length = 732 Score = 26.2 bits (55), Expect = 1.5 Identities = 14/37 (37%), Positives = 23/37 (62%) Frame = +3 Query: 75 NPFQNVEKSLQSMPLTRGTMLLNLQEKAKVRLLPLSV 185 NPF N ++S+++MP L+NLQE + + P S+ Sbjct: 115 NPFPNGKQSIKAMP-----SLVNLQEDSVISKFPNSL 146 >SPBC23G7.10c |||NADH-dependent flavin oxidoreductase |Schizosaccharomyces pombe|chr 2|||Manual Length = 395 Score = 25.0 bits (52), Expect = 3.5 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = +2 Query: 251 RSPRLVLEVAQHLGENTVRTIAMD 322 R+P LVL+ A LGEN + D Sbjct: 362 RNPSLVLDSANQLGENVAWPVQYD 385 >SPCC1795.09 |yps1||aspartic protease Yps1|Schizosaccharomyces pombe|chr 3|||Manual Length = 521 Score = 24.6 bits (51), Expect = 4.6 Identities = 13/43 (30%), Positives = 25/43 (58%) Frame = +2 Query: 5 FLKMLGAISRVGSGILAVKSVAEKSLSECGKIVAVNAVNKRDY 133 F+K++ ++ G+G+LA+ VA+ ++ N + KRDY Sbjct: 11 FIKLVSSLQYTGNGVLALDFVAKTFPNQ------ENQLEKRDY 47 >SPBC56F2.04 |utp20||U3 snoRNP protein Utp20|Schizosaccharomyces pombe|chr 2|||Manual Length = 2493 Score = 24.2 bits (50), Expect = 6.1 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = +2 Query: 209 DNLPPILNALEVQNRSPRLVLEVAQHLGENTV 304 D + I NAL+ Q RSP L E+ + +N + Sbjct: 2290 DFVTQISNALQAQLRSPVLSEELGMQVAKNLI 2321 >SPAC29E6.09 ||SPAC30.13|sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 339 Score = 24.2 bits (50), Expect = 6.1 Identities = 9/23 (39%), Positives = 16/23 (69%) Frame = +2 Query: 206 EDNLPPILNALEVQNRSPRLVLE 274 +DN+ +L+ALE+QN + +E Sbjct: 59 DDNVETLLSALEIQNEKSKQQVE 81 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,425,055 Number of Sequences: 5004 Number of extensions: 25011 Number of successful extensions: 70 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 64 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 69 length of database: 2,362,478 effective HSP length: 65 effective length of database: 2,037,218 effective search space used: 107972554 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -