BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0215 (358 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090815-2|BAC57906.1| 973|Anopheles gambiae reverse transcript... 25 0.85 AY745233-1|AAU93512.1| 100|Anopheles gambiae SOD3B protein. 23 2.6 >AB090815-2|BAC57906.1| 973|Anopheles gambiae reverse transcriptase protein. Length = 973 Score = 25.0 bits (52), Expect = 0.85 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +1 Query: 4 ISENVGGNKSSWKR 45 I N+GG KSSW+R Sbjct: 739 IMPNIGGPKSSWRR 752 >AY745233-1|AAU93512.1| 100|Anopheles gambiae SOD3B protein. Length = 100 Score = 23.4 bits (48), Expect = 2.6 Identities = 10/31 (32%), Positives = 15/31 (48%) Frame = -1 Query: 331 FSTVHGNGPNCVLTQMLGYLKYEAGRSILHL 239 +S GN NC+ ++G + E LHL Sbjct: 70 YSKTTGNSGNCIACAIIGVAREEYFAERLHL 100 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 365,736 Number of Sequences: 2352 Number of extensions: 6286 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 563,979 effective HSP length: 57 effective length of database: 429,915 effective search space used: 26224815 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -