BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0215 (358 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U10402-2|AAA19068.2| 538|Caenorhabditis elegans Atp synthase su... 97 3e-21 AF003134-6|AAB54146.3| 827|Caenorhabditis elegans Hypothetical ... 27 3.9 Z68000-3|CAA91971.1| 1225|Caenorhabditis elegans Hypothetical pr... 27 5.1 Z81477-5|CAB03926.1| 334|Caenorhabditis elegans Hypothetical pr... 26 8.9 U23521-6|AAC46812.1| 469|Caenorhabditis elegans Hypothetical pr... 26 8.9 >U10402-2|AAA19068.2| 538|Caenorhabditis elegans Atp synthase subunit protein 2 protein. Length = 538 Score = 97.1 bits (231), Expect = 3e-21 Identities = 44/54 (81%), Positives = 49/54 (90%) Frame = +2 Query: 194 DVQFEDNLPPILNALEVQNRSPRLVLEVAQHLGENTVRTIAMDGTEGLVRGQPV 355 DVQF++NLPPILN LEV RSPRL+LEV+QHLG+N VR IAMDGTEGLVRGQPV Sbjct: 81 DVQFDENLPPILNGLEVVGRSPRLILEVSQHLGDNVVRCIAMDGTEGLVRGQPV 134 >AF003134-6|AAB54146.3| 827|Caenorhabditis elegans Hypothetical protein ZC581.9 protein. Length = 827 Score = 27.1 bits (57), Expect = 3.9 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -1 Query: 127 PLVNGIDCNDFSTF 86 PLVNG+ C D STF Sbjct: 594 PLVNGLACKDLSTF 607 >Z68000-3|CAA91971.1| 1225|Caenorhabditis elegans Hypothetical protein C05C9.3 protein. Length = 1225 Score = 26.6 bits (56), Expect = 5.1 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = -1 Query: 226 NRRQVIFELHIYHSTDNGNNLTLAFSCRFS 137 N + V ++LH H T NN F+ RFS Sbjct: 1196 NHQHVQYQLHQQHMTVRNNNHEAGFTNRFS 1225 >Z81477-5|CAB03926.1| 334|Caenorhabditis elegans Hypothetical protein C27C7.7 protein. Length = 334 Score = 25.8 bits (54), Expect = 8.9 Identities = 9/20 (45%), Positives = 15/20 (75%) Frame = +2 Query: 239 EVQNRSPRLVLEVAQHLGEN 298 ++Q PRL+ ++A+HLG N Sbjct: 73 QLQAEQPRLLTKLAEHLGSN 92 >U23521-6|AAC46812.1| 469|Caenorhabditis elegans Hypothetical protein F41C3.5 protein. Length = 469 Score = 25.8 bits (54), Expect = 8.9 Identities = 16/57 (28%), Positives = 28/57 (49%), Gaps = 4/57 (7%) Frame = +3 Query: 57 LNQLLRNPFQNVEKSLQSMPLTRGTMLLNLQEKAKVRL---LPLSV-LW*MCNSKIT 215 L Q L+N Q+ + +P T +L+ KVR +P ++ W +C+ K+T Sbjct: 306 LYQFLKNKSQSQKPLKADVPCLNDTEMLSYMNNPKVRKAIHIPFNLGKWDICSDKVT 362 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,970,059 Number of Sequences: 27780 Number of extensions: 140381 Number of successful extensions: 346 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 324 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 346 length of database: 12,740,198 effective HSP length: 73 effective length of database: 10,712,258 effective search space used: 482051610 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -