BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0215 (358 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value U26026-1|AAA69069.1| 377|Apis mellifera long-wavelength rhodops... 23 0.82 DQ011227-1|AAY63896.1| 484|Apis mellifera Amt-1-like protein pr... 23 1.1 AY703752-1|AAU12748.1| 152|Apis mellifera long-wavelength rhodo... 23 1.4 AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 22 2.5 EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. 21 4.4 EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. 21 4.4 AB194707-1|BAD69622.1| 247|Apis mellifera heme oxygenase protein. 21 5.8 AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor typ... 20 7.6 >U26026-1|AAA69069.1| 377|Apis mellifera long-wavelength rhodopsin protein. Length = 377 Score = 23.4 bits (48), Expect = 0.82 Identities = 10/33 (30%), Positives = 19/33 (57%) Frame = +2 Query: 14 MLGAISRVGSGILAVKSVAEKSLSECGKIVAVN 112 MLG +S +G+G++ ++ KSL + +N Sbjct: 61 MLGFVSAMGNGMVVYIFLSTKSLRTPSNLFVIN 93 >DQ011227-1|AAY63896.1| 484|Apis mellifera Amt-1-like protein protein. Length = 484 Score = 23.0 bits (47), Expect = 1.1 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = +2 Query: 5 FLKMLGAISRVGSGILAVKSVAEKSLSEC 91 FLK LGA+ GSG AV V S C Sbjct: 172 FLKKLGAVDIAGSG--AVHLVGGSSALAC 198 >AY703752-1|AAU12748.1| 152|Apis mellifera long-wavelength rhodopsin protein. Length = 152 Score = 22.6 bits (46), Expect = 1.4 Identities = 10/33 (30%), Positives = 19/33 (57%) Frame = +2 Query: 14 MLGAISRVGSGILAVKSVAEKSLSECGKIVAVN 112 MLG +S +G+G++ ++ KSL + +N Sbjct: 27 MLGFVSVMGNGMVVYIFLSTKSLRTPSNLFVIN 59 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 21.8 bits (44), Expect = 2.5 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = +2 Query: 251 RSPRLVLEVAQHLGENTVRTIAMDGTE 331 RSP + ++AQ+ G N + A+D T+ Sbjct: 897 RSPDTLRKIAQNRGTNPLAPDAVDLTQ 923 >EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. Length = 684 Score = 21.0 bits (42), Expect = 4.4 Identities = 11/38 (28%), Positives = 17/38 (44%) Frame = -1 Query: 355 YGLPTD*AFSTVHGNGPNCVLTQMLGYLKYEAGRSILH 242 +G P D + GPN + +L Y K E +I + Sbjct: 647 FGFPLDKPLYDFNYEGPNMLFKDILIYHKDEFDMNITY 684 >EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. Length = 684 Score = 21.0 bits (42), Expect = 4.4 Identities = 11/38 (28%), Positives = 17/38 (44%) Frame = -1 Query: 355 YGLPTD*AFSTVHGNGPNCVLTQMLGYLKYEAGRSILH 242 +G P D + GPN + +L Y K E +I + Sbjct: 647 FGFPLDKPLYDFNYEGPNMLFKDILIYHKDEFDMNITY 684 >AB194707-1|BAD69622.1| 247|Apis mellifera heme oxygenase protein. Length = 247 Score = 20.6 bits (41), Expect = 5.8 Identities = 8/29 (27%), Positives = 16/29 (55%) Frame = -1 Query: 274 LKYEAGRSILHLKGI*NRRQVIFELHIYH 188 L+ + ++HLK I + ++ +IYH Sbjct: 100 LRDSVTKYLIHLKEIEDTEPILLIAYIYH 128 >AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor type D2 protein. Length = 456 Score = 20.2 bits (40), Expect = 7.6 Identities = 7/13 (53%), Positives = 8/13 (61%) Frame = +1 Query: 88 MWKNRCSQCR*QE 126 +W CSQC QE Sbjct: 356 LWSGFCSQCIWQE 368 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 95,238 Number of Sequences: 438 Number of extensions: 1571 Number of successful extensions: 8 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 51 effective length of database: 124,005 effective search space used: 8308335 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -