BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0215 (358 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g08690.1 68418.m01034 ATP synthase beta chain 2, mitochondria... 81 2e-16 At5g08680.1 68418.m01033 ATP synthase beta chain, mitochondrial,... 81 2e-16 At5g08670.1 68418.m01032 ATP synthase beta chain 1, mitochondria... 81 2e-16 At3g54040.1 68416.m05975 photoassimilate-responsive protein-rela... 31 0.23 At2g33860.1 68415.m04157 auxin-responsive factor (ARF3) / ETTIN ... 30 0.52 At5g60450.1 68418.m07582 auxin-responsive factor (ARF4) contains... 27 2.8 At5g39880.1 68418.m04837 expressed protein 27 3.7 At1g51910.1 68414.m05851 protein kinase family protein contains ... 27 4.9 At2g15560.1 68415.m01782 expressed protein contains Pfam profile... 26 6.4 >At5g08690.1 68418.m01034 ATP synthase beta chain 2, mitochondrial identical to SP|P83484 ATP synthase beta chain 2, mitochondrial precursor (EC 3.6.3.14) {Arabidopsis thaliana}; strong similarity to SP|P17614 ATP synthase beta chain, mitochondrial precursor (EC 3.6.3.14) {Nicotiana plumbaginifolia}; contains Pfam profiles PF00006: ATP synthase alpha/beta family nucleotide-binding domain, PF00306: ATP synthase ab C terminal, PF02874: ATP synthase alpha/beta family beta-barrel domain; supporting cDNA gi|26452187|dbj|AK118582.1| Length = 556 Score = 81.4 bits (192), Expect = 2e-16 Identities = 40/57 (70%), Positives = 47/57 (82%), Gaps = 2/57 (3%) Frame = +2 Query: 194 DVQFEDN--LPPILNALEVQNRSPRLVLEVAQHLGENTVRTIAMDGTEGLVRGQPVL 358 DV+FED LPPI+ +LEVQ+ RLVLEV+ HLG+N VRTIAMDGTEGLVRG+ VL Sbjct: 95 DVRFEDQEGLPPIMTSLEVQDHPTRLVLEVSHHLGQNVVRTIAMDGTEGLVRGRKVL 151 >At5g08680.1 68418.m01033 ATP synthase beta chain, mitochondrial, putative strong similarity to SP|P83483 ATP synthase beta chain 1, mitochondrial precursor (EC 3.6.3.14) {Arabidopsis thaliana}, SP|P17614 ATP synthase beta chain, mitochondrial precursor (EC 3.6.3.14) {Nicotiana plumbaginifolia}; contains Pfam profiles PF00006: ATP synthase alpha/beta family nucleotide-binding domain, PF00306: ATP synthase ab C terminal, PF02874: ATP synthase alpha/beta family beta-barrel domain Length = 559 Score = 81.4 bits (192), Expect = 2e-16 Identities = 40/57 (70%), Positives = 47/57 (82%), Gaps = 2/57 (3%) Frame = +2 Query: 194 DVQFEDN--LPPILNALEVQNRSPRLVLEVAQHLGENTVRTIAMDGTEGLVRGQPVL 358 DV+FED LPPI+ +LEVQ+ RLVLEV+ HLG+N VRTIAMDGTEGLVRG+ VL Sbjct: 98 DVRFEDQEGLPPIMTSLEVQDHPTRLVLEVSHHLGQNVVRTIAMDGTEGLVRGRKVL 154 >At5g08670.1 68418.m01032 ATP synthase beta chain 1, mitochondrial identical to SP|P83483 ATP synthase beta chain 1, mitochondrial precursor (EC 3.6.3.14) {Arabidopsis thaliana}; strong similarity to SP|P17614 ATP synthase beta chain, mitochondrial precursor (EC 3.6.3.14) {Nicotiana plumbaginifolia}; contains Pfam profiles PF00006: ATP synthase alpha/beta family nucleotide-binding domain, PF00306: ATP synthase ab C terminal, PF02874: ATP synthase alpha/beta family beta-barrel domain; supporting cDNA gi|26452102|dbj|AK118538.1| Length = 556 Score = 81.4 bits (192), Expect = 2e-16 Identities = 40/57 (70%), Positives = 47/57 (82%), Gaps = 2/57 (3%) Frame = +2 Query: 194 DVQFEDN--LPPILNALEVQNRSPRLVLEVAQHLGENTVRTIAMDGTEGLVRGQPVL 358 DV+FED LPPI+ +LEVQ+ RLVLEV+ HLG+N VRTIAMDGTEGLVRG+ VL Sbjct: 95 DVRFEDQEGLPPIMTSLEVQDHPTRLVLEVSHHLGQNVVRTIAMDGTEGLVRGRKVL 151 >At3g54040.1 68416.m05975 photoassimilate-responsive protein-related contains weak similarity to mRNA inducible by sucrose and salicylic acid expressed in sugar-accumulating tobacco plants (GI:871487) [Nicotiana tabacum] Length = 183 Score = 31.1 bits (67), Expect = 0.23 Identities = 17/44 (38%), Positives = 24/44 (54%) Frame = +2 Query: 209 DNLPPILNALEVQNRSPRLVLEVAQHLGENTVRTIAMDGTEGLV 340 +NLP + + + R +LE A GE T RT A+D EG+V Sbjct: 29 ENLPTNMCSFSISASGKRCILETANVAGEFTCRTSAVD-VEGIV 71 >At2g33860.1 68415.m04157 auxin-responsive factor (ARF3) / ETTIN protein (ETT) identical to ETTIN GB:AF007788 from [Arabidopsis thaliana] Length = 608 Score = 29.9 bits (64), Expect = 0.52 Identities = 16/40 (40%), Positives = 22/40 (55%), Gaps = 1/40 (2%) Frame = -3 Query: 299 CSHPNVGLPQVRGGEIDFAPQGHLESEAGY-LRIAHLPQH 183 C+ P + LP+ RG + + PQGHLE + I LP H Sbjct: 59 CAGPLISLPK-RGSLVLYFPQGHLEQAPDFSAAIYGLPPH 97 >At5g60450.1 68418.m07582 auxin-responsive factor (ARF4) contains Pfam profile: PF02362 B3 DNA binding domain; identical to cDNA auxin response factor 4 (ARF4) GI:4102597 Length = 788 Score = 27.5 bits (58), Expect = 2.8 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = -3 Query: 299 CSHPNVGLPQVRGGEIDFAPQGHLESEA 216 C+ P LP+ +G + + PQGHLE +A Sbjct: 70 CAGPLTCLPK-KGNVVVYFPQGHLEQDA 96 >At5g39880.1 68418.m04837 expressed protein Length = 363 Score = 27.1 bits (57), Expect = 3.7 Identities = 12/40 (30%), Positives = 22/40 (55%) Frame = +3 Query: 102 LQSMPLTRGTMLLNLQEKAKVRLLPLSVLW*MCNSKITCL 221 LQ++P T T +LN +E++ + ++ MC +T L Sbjct: 44 LQTLPFTEITEILNRKERSAPKTPEFKAMFTMCKGYVTYL 83 >At1g51910.1 68414.m05851 protein kinase family protein contains Serine/Threonine protein kinases active-site signature, PROSITE:PS00108 Length = 876 Score = 26.6 bits (56), Expect = 4.9 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = +2 Query: 215 LPPILNALEVQNRSPRLVLEVAQ 283 LPP++NALEV L+LE Q Sbjct: 343 LPPLINALEVYTLVENLLLETYQ 365 >At2g15560.1 68415.m01782 expressed protein contains Pfam profile PF04396: Protein of unknown function, DUF537 Length = 489 Score = 26.2 bits (55), Expect = 6.4 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = -3 Query: 260 GEIDFAPQGHLESEAGYLRIAHLP 189 G++DFAP H+ + GY I +P Sbjct: 152 GDVDFAPALHILGQRGYTVILVIP 175 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,636,485 Number of Sequences: 28952 Number of extensions: 136165 Number of successful extensions: 319 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 315 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 319 length of database: 12,070,560 effective HSP length: 72 effective length of database: 9,986,016 effective search space used: 459356736 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -