BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0214 (424 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF592538-1|ABQ95984.1| 582|Tribolium castaneum beta-N-acetylglu... 26 0.17 AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription fa... 21 4.9 >EF592538-1|ABQ95984.1| 582|Tribolium castaneum beta-N-acetylglucosaminidase NAG3 protein. Length = 582 Score = 25.8 bits (54), Expect = 0.17 Identities = 13/48 (27%), Positives = 23/48 (47%), Gaps = 2/48 (4%) Frame = -3 Query: 278 LIMFSTCEQTVLTAASSFLD--PNHFSTFRRRGFTMRMSTAKCLKFLL 141 L+MFS + T PN ++ F + +T + KC+K+L+ Sbjct: 11 LLMFSYTDNVSSTRTKYLRTNFPNFYNDFEVQRYTWKCENQKCVKYLV 58 >AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription factor protein. Length = 441 Score = 21.0 bits (42), Expect = 4.9 Identities = 8/28 (28%), Positives = 14/28 (50%) Frame = +3 Query: 12 SARGSTKPKHEANCSKSESQNPRRAYGP 95 S S P ++ + + SQ+P + Y P Sbjct: 325 SLTSSPPPPYQISAQPTPSQSPNQIYQP 352 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 106,441 Number of Sequences: 336 Number of extensions: 2153 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 51 effective length of database: 105,449 effective search space used: 9384961 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -