BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0214 (424 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_19540| Best HMM Match : Pro_isomerase (HMM E-Value=1.5e-23) 171 2e-43 SB_52819| Best HMM Match : E-MAP-115 (HMM E-Value=0.82) 29 1.2 SB_42363| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.1 SB_7938| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.1 SB_44616| Best HMM Match : rve (HMM E-Value=0.012) 28 2.8 SB_36341| Best HMM Match : DUF329 (HMM E-Value=1.7) 28 2.8 SB_36215| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.7 SB_41075| Best HMM Match : RVT_1 (HMM E-Value=2.1e-30) 28 3.7 SB_23757| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.4 SB_2047| Best HMM Match : Ependymin (HMM E-Value=6e-05) 27 6.4 SB_58953| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.5 SB_50937| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.5 SB_19506| Best HMM Match : Viral_helicase1 (HMM E-Value=2.7) 27 8.5 >SB_19540| Best HMM Match : Pro_isomerase (HMM E-Value=1.5e-23) Length = 741 Score = 171 bits (416), Expect = 2e-43 Identities = 75/128 (58%), Positives = 100/128 (78%) Frame = +1 Query: 40 MKQIVANQKVKIPDGLTVHVKSRLVTVKGPRGVLKRNFKHLAVDIRMVNPRLLKVEKWFG 219 MK I+A++ V IPD + V VKSR+VTV GPRG LKRNF+HL +++ V ++V+ WF Sbjct: 557 MKTILASETVTIPDNVEVKVKSRVVTVTGPRGTLKRNFRHLRLELTKVGKDKVRVDVWFA 616 Query: 220 SKKELAAVRTVCSHVENMIKGVTKGFQYKMRAVYAHFPINCVTTEGNSIIEIRNFLGEKY 399 S+KELA V+T+ +H+ENMIKGV G++YKMRAVYAHFPIN E +++E+RNFLGEKY Sbjct: 617 SRKELACVKTIITHIENMIKGVIYGYRYKMRAVYAHFPINIAIQENGTLVEVRNFLGEKY 676 Query: 400 IRRVKMAP 423 +RRV+M P Sbjct: 677 VRRVRMRP 684 >SB_52819| Best HMM Match : E-MAP-115 (HMM E-Value=0.82) Length = 883 Score = 29.5 bits (63), Expect = 1.2 Identities = 14/37 (37%), Positives = 22/37 (59%) Frame = +1 Query: 25 QQSPNMKQIVANQKVKIPDGLTVHVKSRLVTVKGPRG 135 Q + +K++ + K K DG+ VH K+ TV+ PRG Sbjct: 99 QNAKRIKKLEEDLKKKTCDGVLVHRKAVAATVEEPRG 135 >SB_42363| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 218 Score = 28.7 bits (61), Expect = 2.1 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -2 Query: 201 LQETRVYHANVNSQVFEVPFENSAGPFNCHQ 109 L TR+ + V+S EV E S P++CHQ Sbjct: 160 LYNTRIPNVTVSSDGGEVELEISDDPYDCHQ 190 >SB_7938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 203 Score = 28.7 bits (61), Expect = 2.1 Identities = 17/48 (35%), Positives = 25/48 (52%) Frame = -3 Query: 254 QTVLTAASSFLDPNHFSTFRRRGFTMRMSTAKCLKFLLRTPRGPLTVT 111 QT++T A F D RRR F+ +S C + L R+P P++ T Sbjct: 85 QTMITTA--FPDTRKSPLTRRRNFSDGVSDLSCTENLARSPCAPVSPT 130 >SB_44616| Best HMM Match : rve (HMM E-Value=0.012) Length = 1189 Score = 28.3 bits (60), Expect = 2.8 Identities = 17/49 (34%), Positives = 28/49 (57%), Gaps = 4/49 (8%) Frame = +1 Query: 70 KIPDGLTVHVKSRLVTVKGPRG---VLKRNFKHL-AVDIRMVNPRLLKV 204 K+ DGL VH+ ++ V K P+ + KR + L A+ I + +P + KV Sbjct: 4 KLDDGLRVHIVTQYVLFKNPKKLEIIAKRQKETLEALQINLDHPHVAKV 52 >SB_36341| Best HMM Match : DUF329 (HMM E-Value=1.7) Length = 197 Score = 28.3 bits (60), Expect = 2.8 Identities = 18/44 (40%), Positives = 20/44 (45%), Gaps = 7/44 (15%) Frame = -2 Query: 192 TRVYHANVNSQVFEVP-------FENSAGPFNCHQTRFHMDRKP 82 TR YH NV VF V F S G N HQ + DR+P Sbjct: 57 TRSYHENVVRPVFGVSDYWYRYEFAKSRGQINRHQLSWREDRQP 100 >SB_36215| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1427 Score = 27.9 bits (59), Expect = 3.7 Identities = 14/38 (36%), Positives = 22/38 (57%), Gaps = 2/38 (5%) Frame = +3 Query: 54 SKSESQNPRRAYGPCEIASGDS*RAPRS--SQKELQTL 161 S+ ++ R Y PC I SG++ APR +KE++ L Sbjct: 1363 SEDDTTTGARRYRPCPIESGNTYEAPRQVVMEKEVEEL 1400 >SB_41075| Best HMM Match : RVT_1 (HMM E-Value=2.1e-30) Length = 1152 Score = 27.9 bits (59), Expect = 3.7 Identities = 12/22 (54%), Positives = 16/22 (72%) Frame = +1 Query: 97 VKSRLVTVKGPRGVLKRNFKHL 162 V++R TV PRG L+RN +HL Sbjct: 1069 VETRSYTVSTPRGELRRNRRHL 1090 >SB_23757| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2834 Score = 27.1 bits (57), Expect = 6.4 Identities = 19/53 (35%), Positives = 27/53 (50%), Gaps = 3/53 (5%) Frame = +1 Query: 223 KKELAAVRTVCSHVENMIKGVTKGFQY-KMRAVYAHFPI--NCVTTEGNSIIE 372 K+ LAA + V + N+ KGVT+G K R V PI V T+G + + Sbjct: 948 KRALAAAKVVKTERVNVAKGVTQGMPVTKGRVVTQGMPITPGRVVTQGKVVTQ 1000 >SB_2047| Best HMM Match : Ependymin (HMM E-Value=6e-05) Length = 739 Score = 27.1 bits (57), Expect = 6.4 Identities = 15/43 (34%), Positives = 24/43 (55%), Gaps = 6/43 (13%) Frame = -2 Query: 150 VPFENS-AGPFNCHQTRFHMD--RKPVW---DFDFLICYNLLH 40 +PF GP +C +TRF +D R P W D+ L+C +++ Sbjct: 6 IPFNALIVGPTSCGKTRFVVDRLRGPFWVKFDYILLVCPTIVY 48 >SB_58953| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 377 Score = 26.6 bits (56), Expect = 8.5 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = -2 Query: 360 ITLSGDTVNGEVSIHSTHLVLEAFSYSF 277 +T+ D G VS H+THLV A S ++ Sbjct: 173 LTIHTDHEGGNVSAHTTHLVGSALSDAY 200 >SB_50937| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2480 Score = 26.6 bits (56), Expect = 8.5 Identities = 14/35 (40%), Positives = 20/35 (57%), Gaps = 3/35 (8%) Frame = -2 Query: 150 VPFENS-AGPFNCHQTRFHMD--RKPVWDFDFLIC 55 +PF GP +C +TRF +D R P D+ L+C Sbjct: 712 IPFNALIVGPTSCGKTRFIVDRLRGPFLDYIVLVC 746 >SB_19506| Best HMM Match : Viral_helicase1 (HMM E-Value=2.7) Length = 828 Score = 26.6 bits (56), Expect = 8.5 Identities = 17/44 (38%), Positives = 20/44 (45%), Gaps = 7/44 (15%) Frame = -2 Query: 192 TRVYHANVNSQVFEV-------PFENSAGPFNCHQTRFHMDRKP 82 TR YH NV VF V F S G + HQ + DR+P Sbjct: 108 TRSYHKNVVKLVFGVNDYWYRYEFAKSRGQIHWHQLSWREDRQP 151 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,169,613 Number of Sequences: 59808 Number of extensions: 290988 Number of successful extensions: 795 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 764 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 795 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 801830705 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -