BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0214 (424 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. 25 1.5 DQ974164-1|ABJ52804.1| 410|Anopheles gambiae serpin 4C protein. 23 4.6 AY146732-1|AAO12092.1| 327|Anopheles gambiae odorant-binding pr... 23 6.0 AB090813-2|BAC57902.1| 1099|Anopheles gambiae reverse transcript... 23 6.0 AY943929-1|AAX49502.1| 755|Anopheles gambiae laccase-2 isoform ... 22 8.0 AB090822-2|BAC57920.1| 1173|Anopheles gambiae reverse transcript... 22 8.0 >M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. Length = 1212 Score = 24.6 bits (51), Expect = 1.5 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = -3 Query: 272 MFSTCEQTVLTAASSFLDPN 213 M S CE+T+ SSF DP+ Sbjct: 327 MISACEKTMQRMTSSFPDPH 346 >DQ974164-1|ABJ52804.1| 410|Anopheles gambiae serpin 4C protein. Length = 410 Score = 23.0 bits (47), Expect = 4.6 Identities = 7/14 (50%), Positives = 10/14 (71%) Frame = +2 Query: 368 LRYVTSWVRNTSEG 409 +RY+ SWV N + G Sbjct: 84 VRYINSWVHNQTHG 97 >AY146732-1|AAO12092.1| 327|Anopheles gambiae odorant-binding protein AgamOBP44 protein. Length = 327 Score = 22.6 bits (46), Expect = 6.0 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = -3 Query: 290 LVTPLIMFSTCEQTVLTAASSFLDPNHFST 201 LVTP ++ + C+ L SFL H T Sbjct: 12 LVTPNLIVAECDTKGLIVEKSFLQSVHDCT 41 >AB090813-2|BAC57902.1| 1099|Anopheles gambiae reverse transcriptase protein. Length = 1099 Score = 22.6 bits (46), Expect = 6.0 Identities = 8/21 (38%), Positives = 14/21 (66%) Frame = -3 Query: 275 IMFSTCEQTVLTAASSFLDPN 213 IM +TC++T+ +S DP+ Sbjct: 263 IMLATCDKTMQRVTTSHSDPH 283 >AY943929-1|AAX49502.1| 755|Anopheles gambiae laccase-2 isoform B protein. Length = 755 Score = 22.2 bits (45), Expect = 8.0 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = -2 Query: 159 VFEVPFENSAGPFNCHQTRFHM 94 V EV EN + PF+ H FH+ Sbjct: 627 VDEVQQENLSHPFHLHGHAFHV 648 >AB090822-2|BAC57920.1| 1173|Anopheles gambiae reverse transcriptase protein. Length = 1173 Score = 22.2 bits (45), Expect = 8.0 Identities = 11/26 (42%), Positives = 13/26 (50%) Frame = -3 Query: 182 TMRMSTAKCLKFLLRTPRGPLTVTRR 105 T + TAK L L+R GP RR Sbjct: 773 TKALRTAKALGCLMRNHSGPKCAKRR 798 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 470,759 Number of Sequences: 2352 Number of extensions: 10323 Number of successful extensions: 17 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 35060166 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -