BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0212 (610 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ263748-1|ABB84470.1| 78|Anopheles gambiae para-type sodium c... 24 4.4 DQ022109-1|AAY51997.1| 66|Anopheles gambiae voltage-gated sodi... 24 4.4 AJ439353-7|CAD27929.1| 555|Anopheles gambiae putative glycerol ... 23 5.8 >DQ263748-1|ABB84470.1| 78|Anopheles gambiae para-type sodium channel variant 1 protein. Length = 78 Score = 23.8 bits (49), Expect = 4.4 Identities = 12/54 (22%), Positives = 24/54 (44%) Frame = -1 Query: 478 WKANEFITISMICSGLLALYARWVQSRWAPAVTPTSAAINMT*AIIIVAHFALL 317 W +F+ MI +L W++S W + + I A +++ +F +L Sbjct: 10 WNFTDFMHSFMIVFRVLC--GEWIESMWDCMLVGDVSCIPFFLATVVIGNFVVL 61 >DQ022109-1|AAY51997.1| 66|Anopheles gambiae voltage-gated sodium channel protein. Length = 66 Score = 23.8 bits (49), Expect = 4.4 Identities = 12/54 (22%), Positives = 24/54 (44%) Frame = -1 Query: 478 WKANEFITISMICSGLLALYARWVQSRWAPAVTPTSAAINMT*AIIIVAHFALL 317 W +F+ MI +L W++S W + + I A +++ +F +L Sbjct: 4 WNFTDFMHSFMIVFRVLC--GEWIESMWDCMLVGDVSCIPFFLATVVIGNFVVL 55 >AJ439353-7|CAD27929.1| 555|Anopheles gambiae putative glycerol kinase protein. Length = 555 Score = 23.4 bits (48), Expect = 5.8 Identities = 13/38 (34%), Positives = 18/38 (47%) Frame = +3 Query: 396 HRLWTHRAYKAKRPLQIILMVMNSFAFQNSAITWIRDH 509 H L T AY+ R I + S A A+ W+RD+ Sbjct: 297 HGLVTTVAYQMGRNAPPIYALEGSVAVAGVAMNWLRDN 334 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 637,907 Number of Sequences: 2352 Number of extensions: 13431 Number of successful extensions: 18 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 59291487 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -