BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0209 (623 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g32190.1 68414.m03959 expressed protein 32 0.36 At2g14740.2 68415.m01663 vacuolar sorting receptor, putative nea... 31 0.82 At2g14740.1 68415.m01662 vacuolar sorting receptor, putative nea... 31 0.82 At3g46050.1 68416.m04983 kelch repeat-containing F-box family pr... 30 1.1 At5g63280.1 68418.m07942 zinc finger (C2H2 type) family protein ... 30 1.4 At3g52850.1 68416.m05824 vacuolar sorting receptor, putative nea... 30 1.4 At2g34940.1 68415.m04289 vacuolar sorting receptor, putative sim... 29 2.5 At5g05530.1 68418.m00600 zinc finger (C3HC4-type RING finger) fa... 29 3.3 At2g14720.2 68415.m01657 vacuolar sorting receptor, putative ide... 29 3.3 At2g14720.1 68415.m01656 vacuolar sorting receptor, putative ide... 29 3.3 At4g31620.1 68417.m04492 transcriptional factor B3 family protei... 28 4.4 At2g22140.1 68415.m02630 expressed protein ; expression supporte... 28 4.4 At5g60930.1 68418.m07643 chromosome-associated kinesin, putative... 28 5.8 At5g15360.1 68418.m01798 hypothetical protein 27 7.7 At3g27580.1 68416.m03446 protein kinase, putative similar to ser... 27 7.7 >At1g32190.1 68414.m03959 expressed protein Length = 422 Score = 31.9 bits (69), Expect = 0.36 Identities = 23/85 (27%), Positives = 30/85 (35%), Gaps = 2/85 (2%) Frame = +1 Query: 169 CPSDYCPTSRCDDQSSCPKPASADCPAPACKCRFNYRRAANGTCIPTRECPPFDCDGDNE 348 CP CP C C C P K F+ +C+ + CP F C Sbjct: 307 CPKPRCPKPSCSCGCGCGDCGCFKCSCPTLKGCFSC--CKKPSCVSSCCCPTFKCSSCFG 364 Query: 349 EYNPCPPFCPGESCSQATE--DGEC 417 + P CP SC + + D EC Sbjct: 365 K-----PKCPKCSCWKCLKCPDTEC 384 Score = 31.1 bits (67), Expect = 0.62 Identities = 12/27 (44%), Positives = 14/27 (51%) Frame = +1 Query: 184 CPTSRCDDQSSCPKPASADCPAPACKC 264 C + C SCPKP CP P+C C Sbjct: 296 CCSGLCRPSCSCPKPR---CPKPSCSC 319 >At2g14740.2 68415.m01663 vacuolar sorting receptor, putative nearly identical to vacuolar sorting receptor homolog [Arabidopsis thaliana] GI:1737220; contains a calcium-binding EGF-like domain signature Length = 628 Score = 30.7 bits (66), Expect = 0.82 Identities = 17/65 (26%), Positives = 33/65 (50%), Gaps = 3/65 (4%) Frame = +1 Query: 130 CADSEILDKCPVDCPSDYCP--TSRCDDQSSCPKPASADCPAPACKCRF-NYRRAANGTC 300 C D + + KC +CP + T +C+D + C + + CP +CK + +Y + +G Sbjct: 493 CVDKDSV-KC--ECPPGFKGDGTKKCEDINECKEKKACQCPECSCKNTWGSYECSCSGDL 549 Query: 301 IPTRE 315 + R+ Sbjct: 550 LYIRD 554 >At2g14740.1 68415.m01662 vacuolar sorting receptor, putative nearly identical to vacuolar sorting receptor homolog [Arabidopsis thaliana] GI:1737220; contains a calcium-binding EGF-like domain signature Length = 628 Score = 30.7 bits (66), Expect = 0.82 Identities = 17/65 (26%), Positives = 33/65 (50%), Gaps = 3/65 (4%) Frame = +1 Query: 130 CADSEILDKCPVDCPSDYCP--TSRCDDQSSCPKPASADCPAPACKCRF-NYRRAANGTC 300 C D + + KC +CP + T +C+D + C + + CP +CK + +Y + +G Sbjct: 493 CVDKDSV-KC--ECPPGFKGDGTKKCEDINECKEKKACQCPECSCKNTWGSYECSCSGDL 549 Query: 301 IPTRE 315 + R+ Sbjct: 550 LYIRD 554 >At3g46050.1 68416.m04983 kelch repeat-containing F-box family protein contains F-box domain Pfam:PF00646 and Kelch motif Pfam:PF01344 Length = 370 Score = 30.3 bits (65), Expect = 1.1 Identities = 16/43 (37%), Positives = 22/43 (51%), Gaps = 2/43 (4%) Frame = -1 Query: 500 TPSCLQKY--FLHLQAGLHGNTMPILPTRWHSPSSVACEQLSP 378 T SC+ K FL++ LH N P P RW S + ++L P Sbjct: 60 TRSCIGKTESFLYVCLDLHRNCYPDCPPRWFIVSPITKQKLKP 102 >At5g63280.1 68418.m07942 zinc finger (C2H2 type) family protein contains Pfam domain, PF00096: Zinc finger, C2H2 type Length = 271 Score = 29.9 bits (64), Expect = 1.4 Identities = 18/59 (30%), Positives = 23/59 (38%) Frame = +1 Query: 145 ILDKCPVDCPSDYCPTSRCDDQSSCPKPASADCPAPACKCRFNYRRAANGTCIPTRECP 321 +L+ C +D C CD S KP S P K R AN +C P + P Sbjct: 131 LLNTTDTKCLADLCGALHCDFVLSSKKPKSKCNPPAVAKNRHLCESVAN-SCFPVSQGP 188 >At3g52850.1 68416.m05824 vacuolar sorting receptor, putative nearly identical to vacuolar sorting receptor homolog (GP:1737218) [Arabidopsis thaliana] Length = 623 Score = 29.9 bits (64), Expect = 1.4 Identities = 16/51 (31%), Positives = 20/51 (39%), Gaps = 1/51 (1%) Frame = +1 Query: 118 TEPPCADSEILD-KCPVDCPSDYCPTSRCDDQSSCPKPASADCPAPACKCR 267 T C D D KCP+ D C+D C + C P CKC+ Sbjct: 484 TYSACVDDHSKDCKCPLGFKGD--GVKNCEDVDECKEKTVCQC--PECKCK 530 >At2g34940.1 68415.m04289 vacuolar sorting receptor, putative similar to BP-80 vacuolar sorting receptor [Pisum sativum] GI:1737222 Length = 618 Score = 29.1 bits (62), Expect = 2.5 Identities = 19/55 (34%), Positives = 27/55 (49%), Gaps = 1/55 (1%) Frame = +1 Query: 115 VTEPPCADSEILD-KCPVDCPSDYCPTSRCDDQSSCPKPASADCPAPACKCRFNY 276 +T C+DSE +CP+ D +C+D C K SA C CKC+ N+ Sbjct: 484 LTFSSCSDSETSGCRCPLGFLGDGL---KCEDIDEC-KEKSA-CKCDGCKCKNNW 533 >At5g05530.1 68418.m00600 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile: PF00097 zinc finger, C3HC4 type (RING finger) Length = 199 Score = 28.7 bits (61), Expect = 3.3 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = +1 Query: 502 CVPYEQCTTCPENEERTCLQGLCRPQKCIEKND 600 C+P + T P NE CL+ LC ++ IE +D Sbjct: 136 CIPAKSIT--PVNECTICLEELCHDEESIETHD 166 >At2g14720.2 68415.m01657 vacuolar sorting receptor, putative identical to GB:U79960 GI:1737220; contains a calcium-binding EGF-like domain signature Length = 628 Score = 28.7 bits (61), Expect = 3.3 Identities = 16/65 (24%), Positives = 32/65 (49%), Gaps = 3/65 (4%) Frame = +1 Query: 130 CADSEILDKCPVDCPSDYCP--TSRCDDQSSCPKPASADCPAPACKCRF-NYRRAANGTC 300 C D + + KC +CP + +C+D + C + + CP +CK + +Y + +G Sbjct: 493 CVDKDSV-KC--ECPPGFKGDGVKKCEDINECKEKKACQCPECSCKNTWGSYECSCSGDL 549 Query: 301 IPTRE 315 + R+ Sbjct: 550 LYMRD 554 >At2g14720.1 68415.m01656 vacuolar sorting receptor, putative identical to GB:U79960 GI:1737220; contains a calcium-binding EGF-like domain signature Length = 628 Score = 28.7 bits (61), Expect = 3.3 Identities = 16/65 (24%), Positives = 32/65 (49%), Gaps = 3/65 (4%) Frame = +1 Query: 130 CADSEILDKCPVDCPSDYCP--TSRCDDQSSCPKPASADCPAPACKCRF-NYRRAANGTC 300 C D + + KC +CP + +C+D + C + + CP +CK + +Y + +G Sbjct: 493 CVDKDSV-KC--ECPPGFKGDGVKKCEDINECKEKKACQCPECSCKNTWGSYECSCSGDL 549 Query: 301 IPTRE 315 + R+ Sbjct: 550 LYMRD 554 >At4g31620.1 68417.m04492 transcriptional factor B3 family protein low similarity to reproductive meristem gene 1 from [Brassica oleracea var. botrytis] GI:3170424, [Arabidopsis thaliana] GI:13604227; contains Pfam profile PF02362: B3 DNA binding domain Length = 492 Score = 28.3 bits (60), Expect = 4.4 Identities = 19/89 (21%), Positives = 35/89 (39%), Gaps = 4/89 (4%) Frame = -3 Query: 441 DAYSSNKMALPILRRLRTALSGAERRAGIVLFIITVTIERRAFSSRYARSVG----CASV 274 D S ++L R S +E+ + L + + R +F+ ++R+ G C + Sbjct: 129 DDSDSKNISLKKKSRFEAESSSSEKYCLLGLTASNLRLNRVSFTKHFSRANGLTKRCCMI 188 Query: 273 VKSTFAGWRWTVGARRLRTA*LVIASARW 187 +G WT+G R + RW Sbjct: 189 DLMNLSGESWTLGLRHNKRTGQAFIRGRW 217 >At2g22140.1 68415.m02630 expressed protein ; expression supported by MPSS Length = 506 Score = 28.3 bits (60), Expect = 4.4 Identities = 14/33 (42%), Positives = 17/33 (51%) Frame = -2 Query: 259 CRLALDSRRSQASDSLTGHRIGSLDSNQKDSPR 161 C + S D +G RI SLDS +DSPR Sbjct: 69 CSFGSRALASNREDKFSGKRIISLDSEFEDSPR 101 >At5g60930.1 68418.m07643 chromosome-associated kinesin, putative microtubule-associated motor KIF4 , Mus musculus, PIR:A54803 Length = 1294 Score = 27.9 bits (59), Expect = 5.8 Identities = 18/62 (29%), Positives = 24/62 (38%) Frame = +1 Query: 166 DCPSDYCPTSRCDDQSSCPKPASADCPAPACKCRFNYRRAANGTCIPTRECPPFDCDGDN 345 + PSD S D C S+ C C+CR A G+C P+ C C N Sbjct: 1046 ETPSDDAVKS---DVCCCTCSKSSSCKTMKCQCR-----ATKGSCGPSCGCSSVKCSNRN 1097 Query: 346 EE 351 + Sbjct: 1098 AD 1099 >At5g15360.1 68418.m01798 hypothetical protein Length = 253 Score = 27.5 bits (58), Expect = 7.7 Identities = 11/27 (40%), Positives = 15/27 (55%), Gaps = 1/27 (3%) Frame = +1 Query: 376 PGESC-SQATEDGECHLVGRIGIVLPC 453 P +C EDG+CHL G + + L C Sbjct: 43 PASTCLGPIGEDGDCHLPGGLALPLDC 69 >At3g27580.1 68416.m03446 protein kinase, putative similar to serine/threonine protein kinase [Arabidopsis thaliana] gi|217861|dbj|BAA01715 Length = 578 Score = 27.5 bits (58), Expect = 7.7 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +1 Query: 175 SDYCPTSRCDDQSSCPKPASADCPAPAC 258 S YC C DQSSC DC P C Sbjct: 351 SSYCIQPTCVDQSSC--IVQPDCIQPVC 376 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,026,112 Number of Sequences: 28952 Number of extensions: 354813 Number of successful extensions: 1140 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 1065 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1130 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1265787216 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -