BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0208 (698 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC024817-18|AAK68533.1| 342|Caenorhabditis elegans C-type lecti... 29 2.4 AC024817-15|AAU05552.1| 281|Caenorhabditis elegans Hypothetical... 29 3.2 >AC024817-18|AAK68533.1| 342|Caenorhabditis elegans C-type lectin protein 81 protein. Length = 342 Score = 29.5 bits (63), Expect = 2.4 Identities = 11/36 (30%), Positives = 19/36 (52%) Frame = +1 Query: 94 KLIYHTYGAITSLITGGRTSCESAPVDTTTLSISAL 201 K Y ++G + ++ GG TS +DT ++ AL Sbjct: 288 KSTYSSFGTVVGVLVGGATSIPGLSIDTNVIAAPAL 323 >AC024817-15|AAU05552.1| 281|Caenorhabditis elegans Hypothetical protein Y54G2A.37 protein. Length = 281 Score = 29.1 bits (62), Expect = 3.2 Identities = 11/36 (30%), Positives = 19/36 (52%) Frame = +1 Query: 94 KLIYHTYGAITSLITGGRTSCESAPVDTTTLSISAL 201 K Y ++G + ++ GG TS +DT ++ AL Sbjct: 229 KSTYTSFGTVVGVLVGGATSIPGLSIDTNVIAAPAL 264 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,896,753 Number of Sequences: 27780 Number of extensions: 284711 Number of successful extensions: 572 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 556 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 572 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1613473434 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -