BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0206 (513 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly pro... 22 3.2 AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic ac... 22 4.3 >DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly protein 9 protein. Length = 423 Score = 22.2 bits (45), Expect = 3.2 Identities = 7/22 (31%), Positives = 15/22 (68%) Frame = -1 Query: 102 VSSPMFHVQHSQMLWISHRKFQ 37 +SS ++ Q+++ +WI K+Q Sbjct: 360 ISSNIYERQNNEYIWIVSNKYQ 381 >AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic acetylcholine Apisa7-2 subunit protein. Length = 461 Score = 21.8 bits (44), Expect = 4.3 Identities = 8/31 (25%), Positives = 18/31 (58%) Frame = -1 Query: 123 P*YHSDVVSSPMFHVQHSQMLWISHRKFQDN 31 P Y S V+++ + +++W+SH F+ + Sbjct: 100 PQYSSAVINTNVIVSHTGEVVWLSHGIFRSS 130 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 138,660 Number of Sequences: 438 Number of extensions: 3252 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14232156 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -