BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0205 (682 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY122146-1|AAM52658.1| 590|Drosophila melanogaster LD01951p pro... 29 5.9 AE014135-39|AAF59363.2| 1459|Drosophila melanogaster CG31998-PA ... 29 5.9 >AY122146-1|AAM52658.1| 590|Drosophila melanogaster LD01951p protein. Length = 590 Score = 29.1 bits (62), Expect = 5.9 Identities = 15/37 (40%), Positives = 23/37 (62%), Gaps = 2/37 (5%) Frame = -3 Query: 557 SILSRSKNLYERYLR--FSLLVRFYHFIVFPSLMTQK 453 SILSR NL +RY+ F LL+ +H + SL+ ++ Sbjct: 91 SILSRKMNLRQRYVNFLFILLIAIHHISLSKSLLLEE 127 >AE014135-39|AAF59363.2| 1459|Drosophila melanogaster CG31998-PA protein. Length = 1459 Score = 29.1 bits (62), Expect = 5.9 Identities = 15/37 (40%), Positives = 23/37 (62%), Gaps = 2/37 (5%) Frame = -3 Query: 557 SILSRSKNLYERYLR--FSLLVRFYHFIVFPSLMTQK 453 SILSR NL +RY+ F LL+ +H + SL+ ++ Sbjct: 91 SILSRKMNLRQRYVNFLFILLIAIHHISLSKSLLLEE 127 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 26,093,700 Number of Sequences: 53049 Number of extensions: 472863 Number of successful extensions: 760 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 737 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 760 length of database: 24,988,368 effective HSP length: 82 effective length of database: 20,638,350 effective search space used: 2971922400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -