BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0205 (682 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z83102-1|CAB05462.2| 356|Caenorhabditis elegans Hypothetical pr... 27 9.4 Z81110-3|CAB03257.1| 323|Caenorhabditis elegans Hypothetical pr... 27 9.4 >Z83102-1|CAB05462.2| 356|Caenorhabditis elegans Hypothetical protein C54C8.1 protein. Length = 356 Score = 27.5 bits (58), Expect = 9.4 Identities = 17/40 (42%), Positives = 21/40 (52%) Frame = -2 Query: 525 KIFKIQPSSAFLSLYCVSLAHDTKETPRNTLNLRNAARLF 406 KI K PSS L Y ++H K+ NTLN+R LF Sbjct: 147 KILKTTPSS-LLKYYVEQVSHG-KQFYMNTLNIRTKEELF 184 >Z81110-3|CAB03257.1| 323|Caenorhabditis elegans Hypothetical protein T01D3.4 protein. Length = 323 Score = 27.5 bits (58), Expect = 9.4 Identities = 12/32 (37%), Positives = 21/32 (65%) Frame = -1 Query: 109 ALICQFYIDAFGS*FIHNYFGLLIQIFTHNAT 14 +++ QF+I F F+H+ GL+I +F NA+ Sbjct: 249 SVLGQFFIYTFSLLFVHSADGLIICLFHFNAS 280 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,041,396 Number of Sequences: 27780 Number of extensions: 265655 Number of successful extensions: 450 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 436 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 450 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1550199966 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -