BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.
Query= NRPG0204
         (713 letters)
Database: bee 
           438 sequences; 146,343 total letters
Searching......................................................done
                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value
AB022907-1|BAA86908.1|  615|Apis mellifera glucose oxidase protein.    25   0.94 
>AB022907-1|BAA86908.1|  615|Apis mellifera glucose oxidase protein.
          Length = 615
 Score = 24.6 bits (51), Expect = 0.94
 Identities = 13/48 (27%), Positives = 23/48 (47%)
 Frame = -2
Query: 160 TGHMMPQSNTIGRNEPRAR*VAVLSVSQTQDTTKPKVIPHNPVISVSL 17
           T  M P  + +    PR +   +  +     + +P+VI  NPV SV++
Sbjct: 548 TAKMGPSYDPMAVVSPRLKVHGIRGLRVADASVQPQVISGNPVASVNM 595
  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 
Gapped
Lambda     K      H
   0.279   0.0580    0.190 
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 196,075
Number of Sequences: 438
Number of extensions: 4338
Number of successful extensions: 5
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 22048515
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -