BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0202 (750 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 25 1.0 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 25 1.0 AY769960-1|AAV34676.1| 603|Apis mellifera soluble guanylyl cycl... 22 7.1 AB181489-1|BAD22772.1| 603|Apis mellifera soluble guanylyl cycl... 22 7.1 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 24.6 bits (51), Expect = 1.0 Identities = 12/38 (31%), Positives = 19/38 (50%) Frame = +1 Query: 61 ATCSAAFASSAPIGSRGPIGATIPLTTPSFKQHPPAQL 174 A+C ++A + S G G L PSF PP+++ Sbjct: 3 ASCLIFVGAAAAVTSAGGHGFDAHLRGPSFVMEPPSRV 40 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 24.6 bits (51), Expect = 1.0 Identities = 12/38 (31%), Positives = 19/38 (50%) Frame = +1 Query: 61 ATCSAAFASSAPIGSRGPIGATIPLTTPSFKQHPPAQL 174 A+C ++A + S G G L PSF PP+++ Sbjct: 3 ASCLIFVGAAAAVTSAGGHGFDAHLRGPSFVMEPPSRV 40 >AY769960-1|AAV34676.1| 603|Apis mellifera soluble guanylyl cyclase beta 1 subunit protein. Length = 603 Score = 21.8 bits (44), Expect = 7.1 Identities = 8/30 (26%), Positives = 18/30 (60%) Frame = +1 Query: 619 VEQLSRTNLYIRGLSPNTTDKDLVQMCQMY 708 ++ L+R +LY+ + + +DLV M + + Sbjct: 320 LDDLTRRSLYLSDIPLHDATRDLVLMSEQF 349 >AB181489-1|BAD22772.1| 603|Apis mellifera soluble guanylyl cyclase beta 1 subunit protein. Length = 603 Score = 21.8 bits (44), Expect = 7.1 Identities = 8/30 (26%), Positives = 18/30 (60%) Frame = +1 Query: 619 VEQLSRTNLYIRGLSPNTTDKDLVQMCQMY 708 ++ L+R +LY+ + + +DLV M + + Sbjct: 320 LDDLTRRSLYLSDIPLHDATRDLVLMSEQF 349 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.315 0.128 0.379 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 136,740 Number of Sequences: 438 Number of extensions: 2513 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23510295 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits)
- SilkBase 1999-2023 -