BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0201 (679 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z92790-3|CAB07228.1| 383|Caenorhabditis elegans Hypothetical pr... 29 4.0 AF077539-3|AAC26291.1| 310|Caenorhabditis elegans Hypothetical ... 28 5.3 >Z92790-3|CAB07228.1| 383|Caenorhabditis elegans Hypothetical protein H03G16.4 protein. Length = 383 Score = 28.7 bits (61), Expect = 4.0 Identities = 16/43 (37%), Positives = 23/43 (53%), Gaps = 1/43 (2%) Frame = -2 Query: 507 SMKTYTELYITVYKYIKLNMIEVSLFYDNNL-PKNHYMYNLNL 382 S KTY E Y+ YK K + +E+ +F + + H NLNL Sbjct: 50 SEKTYREFYVAYYKIGKSSDVELPVFSEMPIVALLHIFENLNL 92 >AF077539-3|AAC26291.1| 310|Caenorhabditis elegans Hypothetical protein T25D3.2 protein. Length = 310 Score = 28.3 bits (60), Expect = 5.3 Identities = 14/49 (28%), Positives = 26/49 (53%), Gaps = 1/49 (2%) Frame = -2 Query: 540 PQIWGPKLITPSMKTYTELYITVYKYIKLNMIEVSL-FYDNNLPKNHYM 397 P+ W PKL P++K + KYIK+ + E ++ D + ++Y+ Sbjct: 125 PRYWVPKLFFPALKNVVLYSEILDKYIKVTVTERAMRLIDEHFGLDYYI 173 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,335,972 Number of Sequences: 27780 Number of extensions: 284654 Number of successful extensions: 519 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 513 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 519 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1539654388 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -