BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0198 (739 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ211693-1|ABB16909.1| 314|Tribolium castaneum dorsocross protein. 25 0.84 AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicas... 23 1.9 U77974-1|AAB36556.1| 276|Tribolium castaneum transcription fact... 23 2.6 AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. 22 4.5 AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. 21 7.9 >DQ211693-1|ABB16909.1| 314|Tribolium castaneum dorsocross protein. Length = 314 Score = 24.6 bits (51), Expect = 0.84 Identities = 14/48 (29%), Positives = 23/48 (47%), Gaps = 2/48 (4%) Frame = -1 Query: 400 PPQLTKREIGSILRV*YSLPLTGFFHFC--PLPLRRRHHSGVWILHYR 263 PPQL E L ++P F+ +C P P+ + SG ++Y+ Sbjct: 232 PPQLEVNERKENLTCQPAVPYVPFYRYCYRPYPVYNQWWSGPLSMYYQ 279 >AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicase protein. Length = 580 Score = 23.4 bits (48), Expect = 1.9 Identities = 11/31 (35%), Positives = 16/31 (51%), Gaps = 1/31 (3%) Frame = +2 Query: 251 PPNTPI-VQNPYATVMSPTKRQWTEMEEPGK 340 PPNT P +MSPT+ ++ + GK Sbjct: 226 PPNTENNCAQPVVVIMSPTRELAIQIADQGK 256 >U77974-1|AAB36556.1| 276|Tribolium castaneum transcription factor homolog protein. Length = 276 Score = 23.0 bits (47), Expect = 2.6 Identities = 9/13 (69%), Positives = 10/13 (76%), Gaps = 1/13 (7%) Frame = +2 Query: 503 ATFIP-HYPPSPP 538 AT +P HYPP PP Sbjct: 155 ATSLPLHYPPPPP 167 >AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. Length = 717 Score = 22.2 bits (45), Expect = 4.5 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = +1 Query: 481 VSQVHTHCNIHPPLSSFPSLRCSTAECRDSPSV 579 V QV TH ++ P +FP+ E +P++ Sbjct: 684 VLQVGTHADLPPVPPNFPTCGDHVPEINSNPNL 716 Score = 21.4 bits (43), Expect = 7.9 Identities = 10/24 (41%), Positives = 12/24 (50%) Frame = -1 Query: 457 ITQSILYSNRRFKPWKSLCPPQLT 386 IT Y R + S+CP QLT Sbjct: 338 ITPGRRYRFRMINSFASVCPAQLT 361 >AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. Length = 712 Score = 21.4 bits (43), Expect = 7.9 Identities = 10/24 (41%), Positives = 12/24 (50%) Frame = -1 Query: 457 ITQSILYSNRRFKPWKSLCPPQLT 386 IT Y R + S+CP QLT Sbjct: 338 ITPGRRYRFRMINSFASVCPAQLT 361 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 168,411 Number of Sequences: 336 Number of extensions: 3923 Number of successful extensions: 12 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19779950 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -