BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0198 (739 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_06_0139 - 11139004-11139031,11139300-11141017,11141408-111414... 29 5.1 05_04_0199 + 18980017-18980759,18981478-18981532 28 8.9 03_02_0312 - 7326092-7326148,7326415-7326540,7327744-7327821,732... 28 8.9 >10_06_0139 - 11139004-11139031,11139300-11141017,11141408-11141477, 11142520-11143361 Length = 885 Score = 28.7 bits (61), Expect = 5.1 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = +1 Query: 235 RLPKRSAQYAYSAKSIRHCDVSYEEAVDRNGR 330 RLPKR ++ K + + EEA++R+GR Sbjct: 119 RLPKRLKRHQQMGKMVSQFRIYVEEAIERHGR 150 >05_04_0199 + 18980017-18980759,18981478-18981532 Length = 265 Score = 27.9 bits (59), Expect = 8.9 Identities = 14/44 (31%), Positives = 25/44 (56%) Frame = +1 Query: 505 NIHPPLSSFPSLRCSTAECRDSPSVSPLHARFLILIY*SVTFII 636 +++PP P S++ CR +PS + L L+L+ SV F++ Sbjct: 48 SVYPP----PPSSSSSSACRHTPSSATLDLLILLLVLFSVAFLL 87 >03_02_0312 - 7326092-7326148,7326415-7326540,7327744-7327821, 7327916-7328178,7328699-7328741,7329581-7329632, 7329705-7329871,7330135-7330194,7330291-7330374, 7330654-7330758,7330840-7330899,7330976-7331032 Length = 383 Score = 27.9 bits (59), Expect = 8.9 Identities = 15/44 (34%), Positives = 22/44 (50%), Gaps = 1/44 (2%) Frame = +2 Query: 221 YSTSTGYPNAPPNTPIV-QNPYATVMSPTKRQWTEMEEPGKWQR 349 Y + P + P P Q+P TV +PT TE ++ GK +R Sbjct: 95 YQQAPMLPGSHPYNPYPGQSPNGTVQTPTSAGGTETDKSGKSKR 138 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,489,265 Number of Sequences: 37544 Number of extensions: 400361 Number of successful extensions: 1081 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1057 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1081 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1945321620 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -