BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0198 (739 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 24 1.3 AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. 22 5.2 DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. 21 9.1 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 24.2 bits (50), Expect = 1.3 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +2 Query: 242 PNAPPNTPIVQNPYATVMSP 301 P PP P QNP ++SP Sbjct: 48 PGGPPGAPPSQNPSQMMISP 67 >AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. Length = 602 Score = 22.2 bits (45), Expect = 5.2 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = -3 Query: 482 TASLHHRLHNPIYPLQQPSVQ 420 T+ + +RL+NP QPS Q Sbjct: 421 TSPMEYRLYNPALIQSQPSPQ 441 >DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. Length = 828 Score = 21.4 bits (43), Expect = 9.1 Identities = 10/37 (27%), Positives = 19/37 (51%) Frame = -1 Query: 250 SVWVTCARTVDKKIKSSYKNVSFIICTARLRLSTNVK 140 S W TV KK+ Y++V ++ +L+ + V+ Sbjct: 230 SQWRKDGGTVKKKVNYVYRSVDQVLEDGKLKPNKKVR 266 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 193,713 Number of Sequences: 438 Number of extensions: 3940 Number of successful extensions: 7 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23023035 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -