BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0196 (669 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF493864-1|ABP65286.1| 247|Apis mellifera triosephoshpate isome... 21 8.0 AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 21 8.0 >EF493864-1|ABP65286.1| 247|Apis mellifera triosephoshpate isomerase protein. Length = 247 Score = 21.4 bits (43), Expect = 8.0 Identities = 14/53 (26%), Positives = 28/53 (52%), Gaps = 1/53 (1%) Frame = +1 Query: 133 GENAEIQMYLSKLQDLVPFMPKNRKISKLEVIQHVID-YICDLQSALENHPAV 288 G N ++ S++ D+V F+ K S +EV+ V Y+ ++ L N+ ++ Sbjct: 8 GGNWKMNGTKSEINDIVGFLKKGPLDSNVEVVVGVPSIYLTYAKNILPNNISI 60 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 21.4 bits (43), Expect = 8.0 Identities = 8/29 (27%), Positives = 17/29 (58%) Frame = +2 Query: 389 TPSSANHPPHTNTEIKRHQKNKTNLTGRR 475 T +SAN+ TN + + ++ + N+T + Sbjct: 992 TQTSANNDKDTNAVVTQSKEARDNITATK 1020 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 174,372 Number of Sequences: 438 Number of extensions: 3374 Number of successful extensions: 8 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20221290 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -